Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Exendin-4 for Sale > China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - large image1
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image1
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image2
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image3
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image4
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image5
China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8 buy - image6

China Largest Manufacturer Supply High quality Nosiheptide CAS 56377-79-8

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

141758-74-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

subi

Packaging:

1g,10g,50g or according to customer's detail requirement.

Price valid (until):

2024-08-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptone

  • Product Description

  • Seller Information

  • Inquiry History

  • Description



      Potassium Acetate


    Wholesale High Purity Nosiheptide

    for research

    We can do customize different size,like 2mg,5mg, 10mg, 15mg, 20mg, 30mg, 50mg,..., if you need to make with your own label and logo, welcome to contact us.



    Introduction:




    Appearance
    White Powder
    Grade Standard
    Industrial Grade
    Storage
    Cool Dry Place
    Shelf Life
    2 years
    Out packing size
    300*400
    Gross Weight
    25(KG)
    Usage
    Myristoyl Pentapeptide-17 / Sympeptide 226 CAS 959610-30-1 can be used as daily chemicals.



    Density 1.391g/cm3
    BoilinEpithalong Point 1335.2ºC at 760 mmHg
    Molecular Formula C37H51N9O10S
    Molecular Weight 813.92000
    Flash Point 761.3ºC
    Exact Mass 813.34800
    PSA 325.58000
    LogP 2.71460
    Index of Refraction 1.617



    • Items Specifications
      Appearance  White powder
      XLogP3  



      2.05480



      Storage    Keep in a cool, dry, dark location




    Packing:

    10mg/vial 10vials/box

    15mg/vial 10vials/box

    20mg/vial 10vials/box 

    30mg/vial 10vials/box 


    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 1
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 2
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 3
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 4
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 5
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 6
    Shop High Purity Peptide Powder Epithalon Acetate  for Anti-Aging-Detailed Image 7

    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 8

    FAQ:

    Q1: Are you trading company or manufacturer?A1: We are chemical manufacturerin China. So we can provide wholesale price.
    Q2: Why is the quoted price different from the listed price?
    A2: As we all know, the price of chemicals is not fixed, butfluctuates with the market.
    Q3: Has the quality of your products passed the test of a third-party authoritative testing agency?
    A3: Yes, all products are strictly tested by our quality control before shipment, and the quality assurance is confirmed and
    approved by third-party laboratories in China, the United States, Canada, Germany, the United Kingdom, Italy, France and other
    countries. If you choose us, we will guarantee to provide you with the highest quality products and services.
    Q4: If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
    A4: Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.
    Q5: How can I get samples, how much is the MOQ, and how can I confirm the product quality?
    A5: We can offer you free samples of our existing products, the delivery time is about 1-3 days, you only need to pay the sample
    shipping cost. Our MOQ starts from 1g-1000g. Confirm the product quality You can send us your product specifications and parameter
    requirements, we will manufacture the product according to your parameter requirements or provide according to the sample quality
    parameters.
    Q6: What are your payment terms?
    A6: We can accept various payment methods,  T/T, T/T, BTC (Bitcoin), etc.
    Q7: Are there any discounts?
    A7: Yes, for bulk purchase orders, we always support with better price.
    Q8: How about the delivery time?
    A8: The delivery time is about 7-20 days after confirming the payment. Delivery times vary from country to country. (excluding
    Chinese holidays)

    For payment: We can accept Bitcoin,Paypal, bank TT to company, bank TT to private account

    How to proceed an order?
    Step 1: When you intended to buy something, pls send me an inquiry by email.
    tep2: I will reply you with a quotation as soon as I receive you inquiry.
    Step3: We will negotiate products, price, package, payment methods and so on.
    Step4: You arrange the payment.
    Step5: I will arrange the shipment after receiving you money.
    Step6: The tracking number of the parcel will be sent to you.
    Step7: Trace the tracking number on website until you receive it.

    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 9
    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 10
    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 11


      Why choose us   


    Superiority

    1.High quality and competitive price.
    2.Free sample for your evaluation.
    3.Promptly delivery by well-reputed shipping lines.
    4.Trial order is available for testing after samples.
    5.We will inform you all the information at every stage in advance.
    6.Packaging can gear to buyers’ special request.

    Our service

    1. Reply your inquiry in 24 working hours.
    2. Customized design is available. OEM are welcomed.
    3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
    staff.
    4. Professional factory: We are manufacturer, specializing in producing all kinds of herb extract for more than 10 years, competitive with good quantity.
    5. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products to be finished in high quality and stable feature.

    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 12
    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 13


     Company Profile 


    Hangzhou Subi Peptide Technology Co., Ltd,it is a professional peptide high-tech company integrating research and development, production and service. 
    BSA, OVA peptide-coupled modification; Modification of peptide such as acetylation, amination, methylation, biotin labeling, fluorescence, etc. The beauty peptides developed and produced by the company include: Anti-wrinkle and anti-aging, whitening and Anti-Spot, tighten and repairing, soothing and anti-allergic, promoting hair growth, promoting hair turning black, removing eye bags and dark circles, breast enhancement and slimming and etc. 

    The core team of Subi Peptide is composed of senior experts and professors with more than 20 years of experience in the R&D and production of peptides. It has first-class liquid phase synthesis and solid phase synthesis technology, as well as mature and leading separation and purification technology, we are able to provide customers with top quality of GMP standards products.

    We believe only good quality can bring good cooperation, quality is our key spirit during our production, we are warmly welcome clients and partner from all over the world contact us for everlasting cooperation, Subi will be your strong, sincere and reliable partner in China.

    Shop China product Cetrorelix high quality factory direct wholesale white raw powder-Detailed Image 14

    Certificates

    Basic Info
    Product Name:

    Exendin-4

    Other Name:

    H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4Exenatide

    CAS No.:

    141758-74-9

    Molecular Formula:

    C184H282N50O60S1

    Molecular Weight:

    4186.57

    Exact Mass:

    4184.03000

    EC Number:

    1312995-182-4

    HScode:

    2933290000

    Characteristics
    PSA:

    1775.05000

    XLogP3:

    -2.16940

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptone

    Location:

    Room A109, No. 29 Dongting Road, Hexi District, Tianjin

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2024

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Exenatide

    Mar 11, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.