Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL-37 high quality supply best service
LL-37 high quality supply best service buy - large image1
LL-37 high quality supply best service buy - image1
LL-37 high quality supply best service buy - image2
LL-37 high quality supply best service buy - image3
LL-37 high quality supply best service buy - image4
LL-37 high quality supply best service buy - image5
LL-37 high quality supply best service buy - image6

LL-37 high quality supply best service

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.44%

Brand:

Million

Packaging:

25kg/Cardboard Drum

Price valid (until):

2025-10-25

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Avanafil,Tirzepatide,Semaglutide,Pregabalin,Nootropics,MT2

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop Apixaban intermediates 3-Chloro-1-(4-nitrophenyl)-5,6-dihydropyridin-2(1H)-one CAS 536760-29-9-Detailed Image 1

    -Product Descrition-


    Shop Axitinib CAS 319460-85-0 supply high quality fast delivery best service-Detailed Image 2


    Why Choose Us

    1 Manufacturer supply, best price and service.

    2、 Safe fast delivery.

    3、 F ree sample.

    4、 Large stock.

    5、 Easy payment: bank transfer,  moneygram, paypal....

    6、 Good reputation, great feedback.

    7、 Customers worldwide: Metrochem Api Pvt Ltd;Bdr Lifesciences Pvt.Ltd;Srini Chem;Eva Pharma;Pharmaffiliates Analytics&Synthetics(p)Ltd;....From India,Egypt,Canada ....


    -Packing&Shipping-

    Shop Apixaban intermediates 3-Chloro-1-(4-nitrophenyl)-5,6-dihydropyridin-2(1H)-one CAS 536760-29-9-Detailed Image 3


    Ship methods

    Special line

    Express

    By air

    By sea

    DHL/TNT/FeDex/UPS

    Delivery

    7-15 days

    3-10 days

    3-5 days

    10-30 days

    Service

    Door to door

    Door to door

    To airport

    To seaport

    Customs clearance

    No

    Possible

    Yes

    Yes


    -Company Profile-

    Shop Apixaban intermediates 3-Chloro-1-(4-nitrophenyl)-5,6-dihydropyridin-2(1H)-one CAS 536760-29-9-Detailed Image 4

    Shop Apixaban intermediates 3-Chloro-1-(4-nitrophenyl)-5,6-dihydropyridin-2(1H)-one CAS 536760-29-9-Detailed Image 5


    About us:

    Founded in 2012, Jinan Million Pharmaceutical Co., Ltd (Jinan Milin Pharmaceutical Co., Ltd) is a modern pharmaceutical enterprise guided by innovation. Million pharm has excellent research and development capabilities and complete industrial bases with international quality management system. It is dedicated to the research, development, production and customization of pharmaceuticals and advanced pharmaceutical intermediates.
     
      Jinan Million Pharmaceutical Co., Ltd has been focusing on the research of Cerebro-cardiovascular drugs, Central nervous system drugs, Anti-cancer drugs, Antibacterial drugs and others for 12 years; the products are: Apixab a n, Lurasidon e , Bexagliflozin, Vortioxetine, L OXO -292/Selpercatinib, Baricitinib and intermediates. Million has worked with reputable customers, like METROCHEM API PVT LTD; BDR LIFESCIENCES PVT.LTD; SRINI CHEM; EVA PHARMA; PHARMAFFILIATES ANALYTICS & SYNTHETICS (P) LTD; ....from India, Egypt, Canada...


    Jinan Million Pharmaceutical Co., Ltd has a 1,500㎡ R&D center in the Zhongguancun E Valley (Qihe) Incubator, equipped with complete test equipment, such as high-performance liquid chromatography, nuclear magnetic resonance spectrometer, liquid chromatography mass spectrometer, automatic polarimeter, etc., which can meet the needs of various  laboratory scale tests in different conditions. The pilot workshop is equipped with 50L and 100L glass reactors, high and low temperature equipment, etc., which can support organic chemical reactions at -100°C or 200°C. In addition, Million has a production site in Linyi city with many independent production lines, such as: production line of Apixabn intermediate 20 tons/year, production line of Lurasidon intermediate 10 tons/year, which can meet the commercial production of various products.
     
      The technical team is composed of high-level talents in major of pharmacy, bio-pharmaceutical or chemical synthesis, of which 10% has doctor’s degree and 15% has master’s degree. The team members are young and energetic with innovative spirit and willing to overcome obstacles.
     
      Jinan Million Pharmaceutical Co., Ltd adheres to the business philosophy of "dedication and innovation", insists on pioneering and innovating, constantly improves the quality system, and vigorously trains technical and management talents to build an elite team and serves customers better. Looking forward to cooperate with you for joint development and common progress.


    -Certification- Shop Apixaban intermediates 3-Chloro-1-(4-nitrophenyl)-5,6-dihydropyridin-2(1H)-one CAS 536760-29-9-Detailed Image 6


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Avanafil,Tirzepatide,Semaglutide,Pregabalin,Nootropics,MT2

    Location:

    Room 1-2208, Lianhecaifu Square, No2177, Tianchen Road, Gaoxin District, Jinan City, Shandong Province, China

    Payment Terms:

    L/C,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2012

    Certifications:

    business license

    Founded in 2012, Jinan Million Pharmaceutical Co., Ltd (Jinan Milin Pharmaceutical Co., Ltd) is a modern pharmaceutical enterprise guided by innovation. Million pharm has excellent research and development capabilities and complete industrial bases with international quality management system. It is dedicated to the research, development, production and customization of pharmaceuticals and advanced pharmaceutical intermediates.
     
    Jinan Million Pharmaceutical Co., Ltd has been focusing on the research of Cerebro-cardiovascular drugs, Central nervous system drugs, Anti-cancer drugs, Antibacterial drugs and others for 12 years; the products are: Apixaban, Lurasidone, Bexagliflozin, Votioxitine, Loxo-292/Selpercatinib, Baricitinib and intermediates. Million has worked with reputable customers, like METROCHEM API PVT LTD; BDR LIFESCIENCES PVT.LTD; INCETPAT PHARM; SRINI CHEM; EVA PHARMA; PHARMAFFILIATES ANALYTICS & SYNTHETICS (P) LTD; ....from India, Egypt, Canada...



    Jinan Million Pharmaceutical Co., Ltd has a 1,500㎡ R&D center in the Zhongguancun E Valley (Qihe) Incubator, equipped with complete test equipment, such as high-performance liquid chromatography, nuclear magnetic resonance spectrometer, liquid chromatography mass spectrometer, automatic polarimeter, etc., which can meet the needs of various  laboratory scale tests in different conditions. The pilot workshop is equipped with 50L and 100L glass reactors, high and low temperature equipment, etc., which can support organic chemical reactions at -100°C or 200°C. In addition, Million has a production site in Linyi city with many independent production lines, such as: production line of Apixabn intermediate 20 tons/year, production line of Lurasidon intermediate 10 tons/year, which can meet the commercial production of various products.
     
    The technical team is composed of high-level talents in major of pharmacy, bio-pharmaceutical or chemical synthesis, of which 10% has doctor’s degree and 15% has master’s degree. The team members are young and energetic with innovative spirit and willing to overcome obstacles.
     
    Jinan Million Pharmaceutical Co., Ltd adheres to the business philosophy of "dedication and innovation", insists on pioneering and innovating, constantly improves the quality system, and vigorously trains technical and management talents to build an elite team and serves customers better. Looking forward to cooperate with you for joint development and common progress.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.