Name:Teriparatide Acetate, Teriparatida , Teriparatidum
Cas No: 52232-67-4(net),99294-94-7(acetate)
Formula: C181H291N55O51S2
Molecular: 4117.71
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity:98%
Appearance: white powder
Source: synthetic
Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide
Parathar,Teriparatide Acetate,Teriparatide Aventis Brand
1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3.Professionalism of service: customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.
F&Q
Q1: How do I make an order?
A: Please contact with us and we will be happy to assist you with your order.
Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T payment (Telegraphic Transfer).
Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q4:Is there a discount?
A:Different quantity has different discount
Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.
Other hot-selling Ingredients:
Anti-wrinkle peptide
Anti-aging peptide
Skin whitening peptide
Anti-oxidant peptide
Hair/Eyelash/Eyebrow peptide
Anti-eyebags Anti-dark circle peptide
Anti-inflammatory Anti-sensitive peptide
Anti-ance Anti-microbial peptide
Anti-cellulite and slimming peptide
Breast firming and facial redefining peptide
... ...
Contact
Email: cecilia@youngshechem.com
Telegram/WeChat: +8618108235634