Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Calcitonin Acetate(Salmon) for Sale > Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - large image1
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image1
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image2
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image3
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image4
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image5
Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon buy - image6

Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon

TDS 1 Inquiries

Unit Price:

$250-280/UNIT FOB

Get Latest Price
CAS No.:

47931-85-1

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

XSY

Packaging:

10vials/box: 5mg-30mg Bag: 0.1g, 1g, 10g, 100g, 1kg, 5kg,10kg

Price valid (until):

2029-11-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,MOTS-C,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop Avanafil-Detailed Image 1 




    Description:

     

    Calcit onin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.

    Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
    The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.


    Name: Calcitonin Acetate(Salmon)
    Cas No: 47931-85-1(net)
    Formula: C145H240N44O48S2
    Molecular: 3431.85
    Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
    Purity:98%
    Appearance: white powder
    Source: synthetic
    Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
    Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
    Purity:98%
    Source: synthetic
    Appearance: White Lyophilized Powder
    Minimum Order Quantity: 1 g
    Brand Name: Yinherb
    Test Method: HPLC
    Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

    Shop Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 2 Shop Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 3

    Shop Buying Thymosin Beta Vials Thymosin B4 Acetate Peptide Thymosin β4 Acetate Tb500 Powder-Detailed Image 4

    Why Choose Us 

    Shop Avanafil-Detailed Image 2

    Our service

    1. 1.We supply Peptides, APIs & Intermediates and so on to satisfy your needs;  
      2. We will reply you for your inquiry in 24 hours;  
      3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

     Packaging

      Shop Avanafil-Detailed Image 3

    Payment

    Shop Avanafil-Detailed Image 4


    Delivery

    Shop Avanafil-Detailed Image 5


      

    FAQ 

     Q:Can i get free sample ? A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .

    Q:Which payment method you accept? A: We accept bank transfer,T/T,PayPal,Credit card etc. and more bigger order we accept L/C at sight

    Q: Can i get tracking number after shipment ? and how long does the shipping take? A: After shipment we will offer you tracking no and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery

    Q: How can you guarantee the quality ? A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.

    Q: How to store it? A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

    Q: How to order this product? A: You can click "contact Supplier" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

    Q: How about the delivery time? A: Shipped within 48 hours after payment is received.Small orders are shipped via express door-to-door.The goods arrive in about7-10 days.

    Q:ls cash on delivery ? A:in most cases,we don't support cash on delivery.

    Q: How much is the commodity? A: As we all know, the price of chemicals is not fixed, but fluctuates with the market. You need to contact me to get the latest product price, we promise to give you the most favorable price.

    Q:About the after-sale service? A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.

    Company infor

     Shandong Xinshunyue was established in 2024 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates, mainly exported to the United States, Europe, India, South Africa, Nigeria and other countries and regions, has a wealth of export experience, to ensure transportation safety, can let each customer as soon as possible to safely receive the goods.

    Certificates
    • Factory 99% Calcitonin Salmon Powder CAS no. 47931-85-1 Chemical Intermediate Calcitonin Salmon Certificates 1

    Basic Info
    Product Name:

    Calcitonin Acetate(Salmon)

    CAS No.:

    47931-85-1

    Molecular Formula:

    C145H240N44O48S2

    Molecular Weight:

    3431.85

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Density:

    1.54±0.1 g/cm3(Predicted)

    Water Solubility:

    Soluble in water at 1mg/ml

    Hazard Identification

    Classification of the substance or mixture

    Acute toxicity - Category 3, Oral

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H301 Toxic if swallowed

    Precautionary statement(s)
    Prevention

    P264 Wash ... thoroughly after handling.

    P270 Do not eat, drink or smoke when using this product.

    Response

    P301+P316 IF SWALLOWED: Get emergency medical help immediately.

    P321 Specific treatment (see ... on this label).

    P330 Rinse mouth.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,MOTS-C,TB500

    Location:

    zibo

    Payment Terms:

    TT against copy of documents,D/A,O/A,100% TT in advance

    Total Employees:

    5-10

    Year of Establishment:

    2025

    CoAs a peptide manufacturer, our products include Retatrutide, Tirzepatide, semaglutide, etc. Our products are of good quality and high purity. Welcome to consult and place an order.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Vietnam

    Calcitonin salmon supplier API Pharmaceutical Polypeptide Protected amino acids made in china

    100 G Jul 19, 2023
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.