Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - large image1
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image1
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image2
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image3
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image4
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image5
LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg  Vials | Lyophilized Powder buy - image6

LL37 | CHINA Warehouse | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.563%

Port:

SHENZHEN

Brand:

HAVHI

Packaging:

10Vial/box

Price valid (until):

2026-06-20

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

  • Product Description

  • Seller Information

  • Description


      Product Detail         


    Product name LL37 CAS NO  

    154947-66-7

    Purity 99% Application releave stress
    Appearance white powder Shipping time 5-12 days
    Specifications 5mg Form Lyophilized Powder(Freeze-Dried Powder)
    Storage Frozen Production Capacity 40000vials/Week
                                                       WHATSAPP:+86 190 0339 6409

    Product Overview

    Epithalon is a high-quality synthetic active peptide with stable molecular structure. It focuses on regulating internal body rhythm, activating cell vitality, and helping maintain steady youthful physical condition for long-term daily wellness care.

    1. Adjust Body Circadian Rhythm

      Optimize natural physical cycle, keep daily routine in balanced and orderly state.
    2. Activate Cellular Vitality

      Nourish body inner cells, slow down physical state decline caused by daily fatigue.
    3. Boost Overall Vitality

      Relieve persistent tiredness, restore energetic physical and mental state efficiently.
    4. Enhance Body Self-regulation

      Strengthen inherent balancing ability, help adapt to different living states easily.
    5. Long-term Gentle Maintenance

      Mild and steady conditioning effect, perfect for daily long-term body nourishment

    Product Advantages


    • High purity raw material, stable biological activity
    • Mild action, no extra physical burden
    • Good permeability, easy for body absorption
    • Strict production standard, reliable quality guarantee

    Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 3




       Company introduction


    Huahui Technolgy o., Ltd. is headquartered in Hong Kong and is an international enterprise specializing in the research and development, supply, and customized services of beauty and health care raw materials.
    The company mainly engages in the wholesale supply of high-end beauty and health care raw materials. It strictly controls the quality throughout the process and adheres to the selection of high-purity, high-standard, and high-quality materials, ensuring the safety and efficacy of the products from the source. At the same time, it supports personalized formula customization and specification customization, and can match different customers' production and research needs as needed.
    Relying on the international business advantages of Hong Kong, the business is oriented towards the global market. It focuses on the supply chain of beauty, health, and big health industries, and with stable supply sources, high-quality products, and professional customized services, it has won the long-term trust and cooperation of customers at home and abroad.


    Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 4 Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 5



    WHY CHOOSE US



    Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 6


      Shipping & Delivery  



    Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 7 Shop SS-31 10mg 50mg, Raw, Peptide factory supplier-Detailed Image 8


     FAQ 


    1. We are the source factory of materials, offering high quality and high purity with wholesale prices.
    2. We can deliver to any region, with dedicated delivery services, ensuring safety and speed.
    3. You can communicate with us for any product. Our products are diverse and we support customization to meet your needs as much as possible.
    4. We support various payment methods, and all details can be discussed.
    5. You can contact me for any questions. I will do my best to answer them for you.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

    Location:

    1st Floor, Building 1, No. 2816 Yixian Road, Baoshan District, Shanghai

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.