Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - large image1
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image1
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image2
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image3
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image4
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image5
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image6

LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price

TDS

Unit Price:

$40-50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

Qihang

Packaging:

LL37 10mg 15mg 20mg 30mg 50mg 60mg ;Weight Loss Peptide

Price valid (until):

2026-07-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,MOTS-C,TB500,KPV

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Sales manager: Liora

    whatsapp:+17392586673

    Email:17392586673@qhzjbio.com

    Bioactive 
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 1 Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 2 Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 3 Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 4 Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 5

    Items Specifications
    Product Name LL37
    Product name LL37
    Peptide Purity 99%
    Peptide Specification  10mg, 15mg, 20mg, 30mg, 50mg, 100mg, 120mg etc in small vials
    CAS NO
    154947-66-7
    Packaging
    Glass vials,10 vials/box
    Storage Cool Dry Place
    Arrival Time 10-15days

     

    154947-66-7

    Our company was established in 2024. Our main products are various peptides,such as weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction.
    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.
    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.
    We therefore focus on sourcing materials of perfect quality and ensure strict internal process control.Our goal is to survive by quality and develop by reputation.
    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work
    In the past two years, our products have been spread across Europe, South America, North America, Southeast Asia, Africa and other more than 30 countries in the world. We work with friends all over the world to develop quality products, reasonable prices and safe and efficient transportation. Products are ordered in quantities ranging from milligrams to tons. Meet the new and old customers to buy.Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 6 Shop LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 7

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,MOTS-C,TB500,KPV

    Location:

    708-95, 7th Floor, Building C, Hangchuang International Plaza, No. 239, Shenzhou 4th Road, National Civil Aerospace Industrial Base, Xi'an City, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Company Profile :
    Qihang Zhouji Biotechnology is an international trading enterprise specializing in the fields of medicine, health, and fine chemicals. Our main business includes global procurement, sales, and supply chain services for pharmaceutical peptides, food additives, plant extracts, pharmaceutical intermediates, and other products. Our business covers multiple countries and regions in Asia, Europe, North America, South America, and the Middle East.
    We rely on a stable high-quality supply chain, strict quality control system, and professional foreign trade operation team to provide compliant, efficient, and stable product supply and one-stop solutions for global pharmaceutical companies, food factories, health product companies, research institutions, and traders. Always adhere to quality as the core, reputation as the foundation, and customer needs as the guide, committed to becoming a professional bridge connecting high-quality resources at home and abroad, and promoting the global coordinated development of the health industry and fine chemical industry.
    In the future, we will continue to expand our global market, deepen our product layout, enhance our service capabilities, and work together with global partners to create long-term stable business value.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.