Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - large image1
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image1
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image2
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image3
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image4
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image5
Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery buy - image6

Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

SH

Packaging:

10mg/vial

Price valid (until):

2026-07-11

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description

    Name:Rui

    ContactInformation:WhatsApp+852 9441 6142

    Email address:sales06@adsh.top

    We very much hope to receive your inquiries about our product information and we will not let you down.


      Product Detail  


    Items Specifications
    Name LL-37
    CAS 154947-66-7
    Specification 5mg

    LL-37 = natural antibiotic + immune modulation + anti-inflammatory + repair promotion, broad-spectrum killing bacteria/fungi/viruses, breaking biofilms, regulating inflammation, accelerating wound healing, and protecting skin and mucous membrane barriers.

    Simultaneously, it acts as an "ignition engine" for tissue repair, promoting epithelial cell migration, angiogenesis, and extracellular matrix remodeling to accelerate wound healing. From combating drug-resistant infections and treating chronic refractory wounds to modulating autoimmune inflammation such as in psoriasis, and even serving as a functional skincare ingredient for barrier repair, LL-37 demonstrates tremendous potential spanning basic immunology to clinical translation, standing as a vital molecular bridge connecting the body’s defense, balance, and regenerative wisdom.



    Shop Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery-Detailed Image 1


      Storage conditions 


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery-Detailed Image 2


      Company Introduction   


    Shanxi An Da Si Hai Technology Co., Ltd. is a reliable manufacturer focusing on peptide products and chemical raw materials.

    We own a strong R&D team and well-organized logistics system to supply high-quality products with fast and secure delivery. Our professional technical and after-sales teams are always on hand to offer full support. Our customers are located in Europe, South Korea, India and other international markets.

    A large range of our products are kept in stock for immediate dispatch. If you have any demands or questions, please let us know. We will give you a detailed reply as soon as possible.

    We commit ourselves to superior products, favorable prices and considerate services. Sincerely look forward to establishing mutually beneficial cooperation with you!

    Shop Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery-Detailed Image 3


      Why Choose Us


    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.

    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.

    Easy Payment: Pay with Bitcoin,USDT,PAYAPL, or bank transfer.

    Good Quality: Our products are great, and we support small test orders.

    Shop Superior quality 99% purity LL37 powder Manufacturer Supply Fast delivery-Detailed Image 4


      FAQ


    Q1:Are you a supplier or a manufacturer?

    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?

    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?

    A: Bitcoin, PayPal.USDT.

    Q4:How is the after-sales service?

    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?

    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?

    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?

    A:Yes, for larger quantity, we always support with better price

    Q8:May I get one sample before placing order?

    A:Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.Mutual effort towards each other.

    Q9:Why should you buy from us not from other suppliers?

    A:

    1. Powerful R & D team

    2. The ability of quantized production from grams to tons;

    3. Various kinds of advanced equipment in the laboratory and plant;

    4 .Strict QC standard to meet the demand of customers, advanced equipment for analysis and assay;

    5. Efficient and safe logistic plans for chemical products transportation;

    6 .Excellent after-sale service.

    7.Highest quality and good package

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.