Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - large image1
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image1
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image2
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image3
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image4
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image5
LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity buy - image6

LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity

TDS 1 Inquiries

Unit Price:

$14-16/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONG KONG

Brand:

Customizable

Packaging:

10 bottles per box

Price valid (until):

2026-07-21

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Email:jdnrndjsooooooqjrn@outlook.com

    whatsapp:+85270530460

    Telegram:@zzppl9998

    Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 1 Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry..


    Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 2 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 3 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 4 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 5 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 6 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 7 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 8 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 9 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 10 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 11

    Peptides are small molecules between amino acids and proteins, with a smaller molecular weight. They do not need to be decomposed and can be directly absorbed and utilized by the human body, with a much higher utilization rate than ordinary proteins.

    Peptide products available on the market have undergone purification processes to remove large molecular impurities and are suitable for daily body supplementation. As the human body ages, its ability to synthesize peptides declines, making it prone to problems such as loose skin, slowed metabolism, and reduced physical strength. Exogenous supplementation can make up for these deficiencies.

    Oral peptides can regulate the body's condition, repair cells within the body, improve sleep quality, regulate basal metabolism, and help maintain energy. Topical skin care peptides can soothe fine lines, firm the skin texture and repair the damaged skin barrier.

    This type of product has mild ingredients and is suitable for most body types, which is different from ordinary health supplements. Taking it in moderation on a daily basis can improve complexion from within and delay the signs of aging. Peptides are absorbed quickly and have a low burden on the stomach and intestines. They are suitable as a long-term care option for both daily maintenance and people who stay up late or have irregular schedules, achieving an improvement in their condition from the inside out.

    Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 12

    Peptides are mainly classified into macromolecular polypeptides, small molecular oligopeptides, as well as dipeptides and tripeptides according to their molecular structure. According to the application direction, they can be further classified into two major categories: beauty peptides and health active peptides.

    Health-preserving active peptides can be quickly absorbed by the stomach and intestines and participate in the body's metabolism. It can repair body cells, regulate immunity, improve fatigue and physical weakness, and at the same time regulate blood sugar and blood lipids, nourish the stomach and intestines, repair mucous membranes, and delay the aging of body functions. It is suitable for people with sub-health conditions in daily life to adjust.

    Beauty peptides are widely used in the field of skin care, such as copper peptides and signal peptides. It can stimulate collagen production, fade fine lines, firm the skin, repair damaged barriers, improve redness, reduce skin sagging and delay facial aging.

    There are also functional peptides, including fat-reducing peptides and anti-aging peptides, which can regulate fat metabolism, inhibit the accumulation of excess fat, and improve body bulkiness.

    The small molecule form does not require secondary decomposition and has a better absorption efficiency than proteins. Daily internal use can regulate the body, and external use can improve skin quality. Consistent supplementation can maintain a youthful state from within and is suitable for body and skin care of different age groups.

    Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 13 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 14 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 15 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 16 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 17 Shop Wholesale Low-Price IPA5 high purity Safe Delivery China--Detailed Image 18


    Items Specifications
    LL-37

    375

    3710

    Specification Ten bottles in one box
    Unit of measurement mg

    Certificates
    • LL-37 375 3710 Factory direct sales, beautiful prices, safe and high purity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

    Location:

    Building 1, Floor 2, No. 96 Banhe Road, Huangpu District, Guangzhou City, Room 2164

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA

    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.