Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - large image1
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image1
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image2
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image3
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image4
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image5
US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available buy - image6

US Warehouse Stock LL37 Cosmetic Peptides 99% Purity Lyophilized Powder, 5mg/10mg Vials Available

TDS 1 Inquiries

Unit Price:

$21-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

guangzhou

Brand:

HF

Packaging:

10mg/vial

Price valid (until):

2026-08-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Basic Information



    WhatsAPP:+85255073603

    +8619933204008
    Email:sales01@yw-jl.cn

    Shop Best price  Oxytocin Acetate vials Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 2 Shop Wholesale Price Body Building Peptides  MGF  High Purity Overseas Warehouse Good Effect-Detailed Image 2


    1. Product Name: LL37 (Human Cathelicidin)
    2. CAS No.: 154947-66-7
    3. Purity: ≥99% HPLC Tested, single impurity ≤0.5%
    4. Appearance: White sterile lyophilized powder
    5. Pack Spec: 5mg/vial, 10mg/vial sterile glass vial
    6. Warehouse: US Local Warehouse, 2-5 days fast delivery
    7. Grade: Cosmetic Grade, low endotoxin for skin external use
    8. Solubility: Soluble in sterile water, easy for cosmetic formulation
    9. Storage: Sealed at -20℃, avoid repeated freeze-thaw
    10. Support Documents: COA, HPLC, MS Report
    Category Peptides Purpose skin conditioning
    Bottle Color Transparent Model 375
    Purity 99% Storage Dry Cool Sealed Container
    Specification 5mg Form Lyophilized Powder(Freeze-Dried Powder)

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 3 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 4


    Product Description


    LL37 is high purity cosmetic peptide with 99% HPLC purity, supplied as white lyophilized powder in 5mg and 10mg sealed vials.

    It is widely used in cosmetic formulation research for skin barrier repair, sensitive skin soothing, redness relief and antibacterial related preclinical tests. The lyophilized powder maintains stable biological activity under low temperature and light-proof storage.

    We provide fast delivery from US warehouse to cut shipping time. Complete test documents including COA and HPLC reports are available for each batch. Both small trial samples and large wholesale orders are supported.

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 5 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 6


    Payment Method 


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 7


       Packaging and Delivery  


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 8 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 9


    Q&A  


    Q1: Are you a supplier or a manufacturer?
    A: We are both a supplier and a manufacturer.
    Q2: How do you make the delivery?
    A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
    Q3: What payment methods do you accept?
    A: We accept Bitcoin and USDT.
    Q4: How about the after-sales service?
    A: We offer high-quality products and guarantee 100% safe delivery.
    Q5: How do you ensure product quality?
    A: We will send you the analysis report (COA) of the sample to confirm the quality.
    Q6: How can we verify the quality of the products before placing an order?
    A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
    Q7: Are there any discount offers?
    A: Yes, the larger the order quantity, the more favorable the price will be .


      Company Profile


    Company Profile: Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
    We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 10 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 11 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 12

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 85, Qingnian Road, Hongqiao District, Tianjin

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.