Product
Supplier
Encyclopedia
Inquiry
Superior quality LL37 buy - large image1
Superior quality LL37 buy - image1
Superior quality LL37 buy - image2
Superior quality LL37 buy - image3
Superior quality LL37 buy - image4
Superior quality LL37 buy - image5
Superior quality LL37 buy - image6

Superior quality LL37

1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

Shunzhicheng

Packaging:

BOX

Price valid (until):

2027-05-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Description


     

      ----------Product Detail----------  

     


    Sales manager: XIXI

    whatsapp:+852 9244 2287

    Email:sales01@tjszc.com

    We sincerely look forward to your inquiries about our products.

    Peptides, as an organic compound, are formed by the dehydration of amino acids and play a variety of important roles in the human body. The following are the main benefits of peptides:
    Nutritional supplementation: Peptides are high-quality nutrients that can be directly absorbed by the human body, providing the body with necessary amino acids, and are absorbed faster than ordinary proteins.
    Promote metabolism: Peptides participate in the body's metabolic process, can regulate enzyme activity in the body, and promote various chemical reactions.
    Strengthen muscles: Peptides can increase the uptake and utilization of amino acids in muscle cells, thereby promoting the synthesis and repair of muscle proteins. It can also stimulate the body to secrete growth hormone, thereby promoting muscle growth. In addition, peptides can also enhance blood circulation, increase blood flow and oxygen supply, and improve muscle nutrition supply and metabolic levels.
    In addition, peptides also have many benefits such as regulating appetite, removing toxins from the body, improving sub-health status, alleviating sexual dysfunction, and improving mental state. However, although peptides have many functions and effects, excessive supplementation may also lead to problems such as overnutrition and obesity. Therefore, in daily life, attention should be paid to the appropriate amount of peptide supplementation to avoid excessive intake. At the same time, when choosing peptide products, you should choose regular channels to purchase them and follow the usage and dosage on the product  instructions.

    1. Product Introduction
    Vasoactive intestinal polypeptide (VIP) is a substance found throughout the body. The highest levels are normally found in the nervous system and gut. It is considered to be a neuroendocrine peptide. Low levels are seen in mold illness patients. It is also low in people with chemical sensitivities.

    2. Product Function

    Neuroendocrine hormone
    Putative neurotransmitter
    Cytokine
    Mediates vasodilation
    lowers arterial blood pressure
    Increases cardiac output
    Mediates immunomodulation
    Mediates mast cell degranulation
    Helps control or send nerve signals
    Helps relax certain muscles along the gastrointestinal tract
    Increases glycogenolysis
    Helps relax bronchioles, smooth muscle of trachea, stomach and gall bladder.
    It increases the amount of water and electrolytes released from the pancreas and gut
    It triggers the release of hormones from the pancreas, gut, and hypothalamus
    It helps break down fat and glycogen
    It stimulates bile flow
    It blocks gastrin, and gastric acid

    3. Product Benefits
    VIP is Essential for Heart Health
    VIP Has Anti-Inflammatory Effects
    VIP Plays A Critical Role in Gut Health
    VIP Can Treat Erectile Dysfunction (ED)
    VIP Plays A Critical Role Respiratory Problems Such As Chronic Obstructive Pulmonary Disease (COPD)
    VIP Could Enhance Immune System Strength
    VIP May Have Neuroprotective Properties
    VIP Has Been Successfully Used in Patients With Chronic Mold Exposure
    VIP is a Possible Treatment Route for Various Types of Arthritis

    Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 1

    Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 1 Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 2 Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 4

    Items Specifications
    Product Name VIP
    Product name Peptide
    CAS NO
    40077-57-4
    Peptide Purity 99%
    Appearance Lyophilized Powder
    Peptide Specification  5mg, 10mg, 15mg, 20mg, 30mg, 50mg, 100mg, 120mg etc in small vials
    Packaging Glass vials,10 vials/box
    Storage Cool Dry Place
    MOQ 1 box(10 vials)

    Our company was established in 2024. Our main products are various peptides,such as weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction.
    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.
    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.
    We therefore focus on sourcing materials of perfect quality and ensure strict internal process control.Our goal is to survive by quality and develop by reputation.
    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work
    In the past two years, our products have been spread across Europe, South America, North America, Southeast Asia, Africa and other more than 30 countries in the world. We work with friends all over the world to develop quality products, reasonable prices and safe and efficient transportation. Products are ordered in quantities ranging from milligrams to tons. Meet the new and old customers to buy. Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 5 Shop Top Quality VIP 10mg 15mg 20mg 30mg 50mg 60mg  Weight Loss Peptide CAS 40077-57-4-Detailed Image 6

    Basic Info


    Characteristics


    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

    Location:

    Room 314A, Block A, Tianjin Youth Entrepreneurship Park, No. 85 Qingnian Road, Hongqiao District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.