Product
Supplier
Encyclopedia
Inquiry
Home > Organic Chemistry > Hydrazine or Hydroxylamine Derivatives > LL-37 for Sale > BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - large image1
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image1
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image2
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image3
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image4
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image5
BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price buy - image6

BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2028-10-11

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Anne
    WhatsApp: +852 6462 7346

    Items Specifications






    Shop BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.


    Shop BC20 BT5 BT10 375  CU50 CU100 CAS154947-66-7 Chinese factory-Detailed Image 2

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price-Detailed Image 3

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop SM15 SM20 SM30 TR5 TR10 CAS2023788-19-2 Quick inventory delivery-Detailed Image 4

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop RT5 RT10 RT15 RT20 RT30 CAS2381089-83-2 sell like hot cakes-Detailed Image 5

    1. Expertise in Peptide Synthesis

    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.


    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


    Shop BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price-Detailed Image 6
    1. 1.Treatment of depression and anxiety disorders:  Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.
    2. 2.Prevention of neurodegenerative diseases:  Retatrutide  has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.
    3. 3.Enhancement of cognitive function:  Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.
    4. 4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.
    5. 5.Promotion of wound healing:  Retatrutide  has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.
    Shop RT5 RT10 RT15 RT20 RT30 CAS2381089-83-2 sell like hot cakes-Detailed Image 7

    Research indicates that retatrutide is likely the most effect incretin-based peptide for weight loss yet developed. In a study in rodents, for instance, just 10 days of retatrutide treatment leads to decreases in total body weight greater than those seen with semaglutide. This occurs when the peptides are administered at the same doses. If retatrutide is given at a lower dose that semaglutide, then it produces similar weight loss effects but with decreased risk of side effects[3]. Thus, retatrutide may offer an alternative treatment option for those who are somewhat intolerant of the side effects of semaglutide.

    A phase 2 study in humans has showed that retatrutide can produced significant reductions in body weight. In fact, trial participants given the highest dose of the peptide lose approximately 20 pounds in just 12 weeks[1]. In another trial, individuals treated for 26 weeks showed changes in waist circumference ranging from -2.1 cm to -10.2 cm[7]. In other words, people taking retatrutide in this trial lost anywhere from 1 inch to ~5 inches off of their waist in just 6 months. Finally, in a trial published in the New England Journal of Medicine, weight loss from retatrutide varied in a dose-dependent manner over the 48 weeks of the trial. Individuals given the lowest dose of the peptide lost 8.7% of their total body weight while those given the highest dose lost more than 24% of their total body weight[8]. Similar results were published in a JAMA article as well

    Shop SM15 SM20 SM30 TR5 TR10 CAS2023788-19-2 Quick inventory delivery-Detailed Image 8

    Shop BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price-Detailed Image 9

    Shop RT5 RT10 RT15 RT20 RT30 CAS2381089-83-2 sell like hot cakes-Detailed Image 10

    Certificates
    • BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 The price is the factory price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.