Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - large image1
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image1
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image2
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image3
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image4
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image5
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast buy - image6

NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast

1 Inquiries

Unit Price:

$10-13/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

香港

Brand:

kangtai

Packaging:

10 bottles per box

Price valid (until):

2026-08-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Made of premium raw materials with high purity and low impurity. It has stable physical properties and excellent water solubility. Rich in biological activity with mild and efficient effect, consistent batch quality and easy storage. Widely used in biological scientific research and related experiments with stable supply and reliable quality.

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Items Specifications
    Grade Pharmaceutical Grade
    Packaging 10 bottles per box
    Content 99%

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 1 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 2 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 3


      company profile


    We are a professional supplier specialized in R&D, production and export of peptide raw materials and laboratory preparation solvents.
    With standardized production conditions and strict quality control procedures, all goods meet international testing standards with stable batch consistency.

    Our business mainly covers Europe, America, Southeast Asia and the Middle East. We support customized solutions for global bulk purchasers.
    Adhering to the principle of Quality Priority & Client First, we keep optimizing processing techniques for laboratory-use products.

    We keep expanding overseas markets with eco-friendly production mode, aiming to become a reliable global supplier.
    Long-term stable partnership cooperation with worldwide clients is highly welcomed.

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 4 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 5


    Shipping & Delivery  


    We support DHL, FedEx, DPD, USPS express, air and sea freight for different order sizes.
    Local warehouses in China, US and Germany help shorten delivery time.
    Temperature-sensitive goods use cold-chain packing, all packages are leak-proof and shock-resistant, complying with international chemical shipping standards.
    All products are for laboratory research use only.

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the warehouse|fast-Detailed Image 6

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide

    Location:

    Room 205-E742, Building F, No. 53 Congyun Road, Huangshi Street, Baiyun District, Guangzhou City

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.