 Home > Biochemical Engineering > Inhibitors > FOXO4-DRI for Sale > Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock buy - large image1

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock buy - image1

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock buy - image2

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock buy - image3

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock buy - image4

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock

Name: Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock
Brand: QSC=Qingdao Sigma Chemical
SKU: pr2408081310
Price: 3.06 USD
Availability: InStock

TDS 30 Inquiries

Unit Price: Get Latest Price 

CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

QINGDAO

Brand:

QSC=Qingdao Sigma Chemical

Packaging:

5mg 10mg 15mg per vial; 10vials/box

Sample Available:

Yes

Price valid (until):

2024-11-14

Contact Supplier

 Chat Now

QIngdao Sigma Chemical Co.,Ltd

Company Type:

Trader

Location:

China

Payment Terms:

100% TT in advance

Average Lead Time:

1 days

Qualification:

Main Products:

bodybuilding Peptide,Steroids,Tirzepatide,semaglutide,Sarms

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Name	Fox04-Dri
CAS NO	CAS 2460055-10-9
Function	Fox04-Dri is an advanced robotic companion designed to provide intelligent assistance and companionship to individuals in various settings. With its sleek design and cutting-edge technology, Fox04-Dri offers a wide range of features and functionalities that enhance the user's everyday life. Equipped with state-of-the-art artificial intelligence, Fox04-Dri can understand and respond to natural language commands and engage in meaningful conversations. Its advanced language processing capabilities enable it to provide information, answer questions, and assist with various tasks, making it an invaluable personal assistant.
Apparence	White Powder
Package	Aluminum Bag;Drums;Paper Box Outside

Shop Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock-Detailed Image 1

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Product Specification

Items	Specifications
Product Name	Tirzepatide
Other Name	LY3298176
CAS	2023788-19-2
Molecular Formula	C225H348N48O68
Appearance	White power
Molar Mass	4813.45

Appearance: Powder

Purity: >98% (or refer to the Certificate of Analysis)

Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Solubility: To be determined

Shelf Life: >2 years if stored properly

Drug Formulation: To be determined

Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

HS Tariff Code: 2934.99.9001

Why choose us

Why choose us?

1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available (Janoshik).

2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

4. Special Service: Drop-shipping if need.

5. Cheapest prices in the market, unbeatable ！

6. Very reputable in the most famous boards such as Meso Rx forum and Professional muscle forums, with tons of positive reviews and blind lab tests done by our customers.

7. Many payment options: Credit card, bank transfer, wise, alipay, paysend, apple pay, google pay, wechat, bitcoin

Shop Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock-Detailed Image 2

Shop Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock-Detailed Image 3

Shop Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock-Detailed Image 4

ECHEMI Editorial Reference

FOXO4-DRI (Retro-Inverso) is a synthetic, slightly modified version of the standard FOXO4 protein. The modification prolongs half-life of the protein and allows it to interfere with normal FOXO4 function. FOXO4-DRI has been shown in research to prevent normal FOXO4 binding to p53, thereby allowing for elimination of senescent cells, improved organ function, and younger tissue “biological age.” FOXO4-DRI impacts insulin signaling, cell cycle regulation, and oxidative stress signaling pathways. FOXO4-DRI is a cell penetrating peptide shown to selectively induce apoptosis of senescent cells thereby reversing effects of aging in animal studies.

Research & Reference Note

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

FOXO4-DRI

Other Name:

FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

CAS No.:

2460055-10-9

Molecular Weight:

Color/Form:

White to off-white

Categories:

Inhibitors

Seller Information

Business Type:
Trader

Main Products:
bodybuilding Peptide,Steroids,Tirzepatide,semaglutide,Sarms

Location:
NO 40 shandong Road,Shibei District, Qingdao City,Shandong Province

Payment Terms:
100% TT in advance

Average lead Time:
1 days

Total Annual Revenue:
$25 million-$50 million

Total Employees:
51-100

Year of Establishment:
2017

Company Certificates
- COA

Inquiry History

30 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	FOXO4-DRI	1 G	Dec 3, 2023
Germany	foxo4-dri	1 G	Aug 23, 2026
United States	Fox04-dri	1 G	May 20, 2026
United States	hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot	2 PCS	Dec 19, 2025
United States	foxo4 dri	10 MT	Dec 13, 2025
United States	Fox04	10 MG	Oct 30, 2024
Canada	Reta	10 PCS	Sep 24, 2026
Germany	FOXO4-DRI	10 MG	Sep 17, 2026
Norway	FOXO4-DRI	200 MG	Sep 3, 2026
United Kingdom	High purity foxo4	1 G	May 31, 2026
United Kingdom	Foxo4-Dri	10 MG	May 5, 2026
United States	Fox04-dri	100 MG	Apr 28, 2026
Cyprus	Foxo4 dri	10 MT	Apr 4, 2026
Cyprus	FOXO4-DRI	1 KG	Feb 2, 2026
United States	FOX04-DRI	10 PCS	Jan 12, 2026
United States	FOX04	10 PCS	Jan 12, 2026
United States	Foxo4 Dri	40 MG	Sep 15, 2025
United States	Fox04 dri	10 MT	Jun 21, 2026
United States	FOX04-DRI powder	10 MT	May 29, 2026
United States	fox04	1 G	Apr 29, 2026

Go to Page

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
High Purity FOXO4 10mgvials Wholesale Prices Lab Direct Shipment Stock	Pharmaceutical Grade/99	$114/BOU EXW	Brown Pie Chemical Co., Ltd.	Inquiry
High Quality FOXO4 Peptide for Cosmetic with good price	Research Grade/99	$20.4-25.5/G FOB	Tianjin Huifeng Technology Co., Ltd.	Inquiry
99% High Purity F410 with Wholesale Price \| Supports third-party testing \| Lyophilized Powder	High Purity Grade/99	$250/UNIT FOB	Tong peptides	Inquiry
DS10 China Peptide chemical peptides Small bottle peptide research peptides DSIP 10mg DS10	Pharmaceutical Grade/99	$72/G FOB	Guangzhou Changkai Trading Co., Ltd.	Inquiry
DS15 DSIP Peptide CAS 62568-57-4 99% Purity Research Peptide Lyophilized Powder Factory Supply with COA	Pharmaceutical Grade/99.55	$89/UNIT FOB	aoxin	Inquiry

Wholesale Price Fox04-Dri Foxo4 Dri Peptide Foxo4-Dri Powder CAS: 2460055-10-9 in Stock

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller