Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - large image1
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image1
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image2
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image3
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image4
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image5
LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment buy - image6

LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment

GMP 3 Inquiries

Unit Price:

$5.3/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

As clients' requirements

Brand:

USA

Packaging:

5mg per vial,10 vials per box

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
United States
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Product description

    Jane Zhang
    WhatsAPP:+852 95471762
    Email:tm05@tmpeptide.com

    LL-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    Shop Wholesales peptides 154947-66-7 LL37 5mg Peptide with safe delivery-Detailed Image 1


    Specifications

    Items Specifications
    CAS NO. 154947-66-7
    MF C205H340N60O53
    Appearance Freeze-dried powder
    EINECS NO.
    211-519-9


    Function & Usage


    Function & Usage

    The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.


      Package & Delivery  


    Package & Delivery

    Shop Wholesales peptides 154947-66-7 LL37 5mg Peptide with safe delivery-Detailed Image 2


      FAQ  


    FAQ 

    Q1: Have your Product Quality been Approved by Third Party Lab

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us. 
     
    Q2: How do you treat quality complaint

    A: First of all, our QC department will do strict examination of our export products by HPLC, UV, GC,TLC and so on in order to reduce the quality problem to near zero. If there is a real quality problem ,caused by us, we will send you free goods for replacement or refund your loss.
     
    Q3: How to cooperate with us

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q4: Do you Accept Sample Order

    A: Yes, we accept small order from 10g, 100g and 1kg for your evaluation quality of our goods.

    Q5: Is there any discount

    A: Yes, for larger quantity, we always support with better price. 

    Q6: Do you accept VISA business credit card

    A: Sorry we don't accept VISA credit card,
    We'd like to accept T/T , Moneygram ,,Paypal and Bitcoin.

    Q7: How long does it take to the goods arrived

    A:It is Depending on your location,
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q8: Do you have any reshipment policy  

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.

    Shop LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment-Detailed Image 3
    Shop LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment-Detailed Image 4
    Shop LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment-Detailed Image 5
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 Peptide Safe Delivery top grade 99% purity cas154947-66-7 with safe shipment is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    1942 Broadway St. STE 314C Boulder CO 80302 US

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.