Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - large image1
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image1
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image2
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image3
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image4
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image5
Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan buy - image6

Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan

TDS 10 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Industrial Grade

Content:

99%

Port:

tianjin

Brand:

HuaMan

Packaging:

10 bottles/box

Price valid (until):

2024-12-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Propylene glycol

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    whatsapp:+52 9431 6380

    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 1

    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 2

    Items Specifications
    Product Name Tirzepatide
    Other Name LY3298176
    CAS 2023788-19-2
    Molecular Formula C225H348N48O68
    Appearance White power
    Molar Mass
    4813.45


    Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes. Tirzepatide (LY3298176) shows significantly better efficacy with regard to glucose control and weight loss than do Dulaglutide.

    Tirzepatide, also known as LY 3298176, is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. Tirzepatide has a greater affinity to GIP receptors than to GLP-1 receptors, and this dual agonist behavior has been shown to produce greater reductions of hyperglycemia compared to a selective GLP-1 receptor agonist. Signaling studies reported that tirzepatide mimics the actions of natural GIP at the GIP receptor. Tirzepatide was approved for improving blood sugar control in adults with type 2 diabetes, as an addition to diet and exercise.

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001



      Other Products  


    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 3


      Our advantage


    Quality:   Purity above 99%, directly produced by the manufacturer, can accept quality testing, and can also customize any content of powder, liquid, oil, etc.

    Transport:   We can accept sea freight, air freight, and express delivery, with a guarantee time of 1-2 weeks and a customs clearance rate of over 99%. Even if the goods are detained, you can resend the freight and I will resend the goods.

    Service:   We can provide sterile water for you to directly mix and inject freeze-dried powder. In addition to powder, we also have liquids, water-based agents, oils, tablets, and professional customized synthesis routes. We provide you with professional guidance on product use, product synthesis, and product customization.

    Price:   We do not engage in price wars. Firstly, our quality can be guaranteed; Secondly, our transportation efficiency and customs clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect. If you have any questions, I will have the answer.


      Company Profile


    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 4 Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 5

    HuaMan Bio acquired early mastery of development and manufacturing of peptides, the short chain amino acids linked by peptide bonds that have enabled new generations of small molecule drugs that closely mimic the body's natural pathways. Now HuaMan Bio possesses first-class capabilities to manufacture peptides at industrial scale and in full compliance with the strictest Good Manufacturing Practice (cGMP) standards.pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.

    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 6



    Transportation & packaging


    Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 7 Shop Fast shipping, safe delivery, high quality weight loss Peptide Tirzepatide 2023788-19-2 30mg HM-Detailed Image 8


      FAQ  


    Q1: What's your MOQ?
    A:It depends on different products,we can accept sample order or provide free sample for your test.

    Q2:How about delivery leadtime?
    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

    Q3: Is there a discount?
    A:Different quantity has different discount.

    Q4:How to start orders or make payments?
    A:Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T.

    Q5: How do you treat quality complaint?
    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

    Q6. We don't know you at all, how can we trust you?
    A: You are always warm welcomed to visit us at any time. Commitment is the No.1 Point of our Enterprise's Value.

    Q7.Do you test all your goods before delivery?
    A:Yes, we have 100% test before delivery,International Authorized Third-Party Test for the products if you need are highly welcomed.

    Certificates
    • Teriparatide 99% White powder High Quality Teriparatide Acetate HuaMan Certificates 1

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Propylene glycol

    Location:

    No .41 Optics Valley Avenue, East Lake High-tech Development Zone, Wuhan ,China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

    Nanjing Huaman Import and Export Co., Ltd was established in 2024 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products , mainly exported to the United States, Europe, India, South Africa, Nigeria and other countries and regions, has a wealth of export experience, to ensure transportation safety, can let each customer as soon as possible to safely receive the goods.
  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.