Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - large image1
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image1
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image2
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image3
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image4
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image5
Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling buy - image6

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling

TDS 10 Inquiries

Unit Price:

$33/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

TianJin

Brand:

Pharma;Conutrix

Packaging:

10 vials/box

Price valid (until):

2027-08-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Basic Parameter Information

    Full Name: Teriparatide (Recombinant Parathyroid Hormone Fragment 1–34)

    Amino Acid Sequence: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

    Molecular Formula: C₁₈₁H₂₉₁N₅₅O₅₁S₂

    Molecular Weight: 4117.82 g/mol

    CAS Number: 52232-67-4

    Appearance: Sterile lyophilized white powder, individually sealed in vials (main specifications: 2mg / 5mg / 10mg)

    Purity: ≥98% tested by HPLC, complete COA quality certification provided with every batch

    R&D Background: Teriparatide is a bioactive truncated fragment of natural human parathyroid hormone. This synthetic peptide retains all core functional segments of full-length parathyroid hormone responsible for bone tissue remodeling and mineral metabolism regulation. Lab-grade teriparatide is prepared for osteoblast cultivation, bone metabolism pathway exploration, mineral balance testing and skeletal degenerative tissue model research, widely adopted in bone cell biology, endocrinology and orthopedic pathology laboratory projects.

    2. Core Mechanism of Action

    Teriparatide binds specifically to parathyroid hormone receptors expressed on osteoblasts, chondrocytes and renal tissue cells to activate signal cascades governing bone turnover and mineral circulation:

    Interact with receptors on bone-forming osteoblasts to stimulate cell proliferation and metabolic activity, boost the synthesis of bone matrix proteins and drive new bone matrix deposition within culture systems;

    Adjust mineral transport signals in renal tissue cell samples to regulate reabsorption of calcium and phosphorus, maintaining balanced mineral concentration inside extracellular fluid environments;

    Coordinate communication between osteoblast and osteoclast precursor cells to remodel bone turnover equilibrium, favoring bone formation processes over bone breakdown under standard culture conditions;

    Enhance vitality and differentiation potential of cartilage progenitor cells, supporting the maintenance of structural integrity in joint tissue co-culture models;

    Trigger downstream gene expression programs linked to bone matrix generation and mineral deposition, serving as a core ligand to map regulatory networks of skeletal tissue growth;

    Balance intracellular mineral storage signals to relieve mineral metabolism disorder features observed in aging skeletal cell and tissue models.

    3. Core Research Efficacy (For Research Laboratory Use Only)

    Osteoblast Proliferation & Bone Matrix Formation Research

    Core experimental probe for cultivating bone-forming cells and exploring osteogenic differentiation pathways; suitable for mineralized nodule formation and bone matrix protein quantitative detection assays.

    Systemic Calcium & Phosphorus Metabolic Balance Research

    Key raw material for studying renal mineral reabsorption mechanisms, supporting cell-level analysis of mineral homeostasis and metabolic bone disorder pathways.

    Bone Turnover Remodeling Mechanism Research

    Adjust the balance between bone generation and bone resorption signals, applied to tissue model experiments simulating low bone mass and skeletal degenerative changes.

    Chondrocyte & Joint Tissue Function Maintenance Research

    Sustain normal proliferative and synthetic activity of cartilage precursor cells, auxiliary reagent for long-term joint tissue co-culture and structural function observation studies.

    Skeletal Aging & Degenerative Bone Lesion Exploration

    Restore weakened osteogenic activity in aged bone cell models, supporting research targeting age-related bone mass loss and skeletal tissue regeneration potential.
    Supplied as sterile lyophilized white powder with HPLC verified purity ≥98%, mainstream vial specifications cover 2mg, 5mg and 10mg. Each shipment includes full supporting documents including COA, MSDS and HPLC chromatogram testing records.
    As a standard synthetic parathyroid hormone fragment ligand, Teriparatide functions as a primary laboratory tool to dissect core regulatory networks governing mammalian bone growth, mineral circulation and skeletal tissue remodeling. Its stable chain structure delivers steady cell permeability and reliable receptor binding activity across diverse in vitro bone, cartilage and renal cell culture systems.
    It serves as essential research material for cell cultivation and tissue model experiments covering bone cell biology, osteogenic differentiation, mineral metabolism balance and age-related skeletal degenerative research.
    Note: For laboratory research use only, not approved for human oral consumption or clinical therapeutic treatment.
    We maintain sufficient stable stock, full sets of export certification paperwork, door-to-door double clearance logistics service with full real-time tracking available for all orders.


      About us  


              Anhui Ruibang Trading Co., Ltd. was established with a clear mission: to simplify international trade for businesses of all sizes. We act as a bridge between manufacturers and global buyers, offering professional sourcing, quality inspection, order coordination, and logistics management.

             Our team brings years of experience in cross-border trade, supplier networks, and export documentation. We understand the challenges of international business — language barriers, quality control, shipping complexities — and we solve them with a client-first approach.
           At Ruibang Trading, we don’t just move goods; we build relationships. Whether you are looking for a reliable supplier, need help consolidating shipments, or want to expand your product line, we provide tailored solutions to meet your goals.
             Our Commitment: Integrity, efficiency, and transparency in every transaction.


     Why choose us 


          Our products are of reliable quality and sell well all over the world, with partners across many countries and regions. We have professional technical support and complete after-sales teams to promptly respond to all your inquiries and demands.

               We always strictly control product quality, adhere to honest business principles, and prioritize quality and service. With stable product strength and thoughtful services, we sincerely welcome global customers to negotiate cooperation and achieve win-win development together.

               We have been deeply engaged in the peptide industry for many years, serving as a source biotechnology factory integrating R&D, synthesis, production and sales.

              We strictly follow production and quality control standards, with the whole process adopting aseptic production and independent lyophilization and packaging. Our products feature stable appearance, good solubility and high activity retention.

              We support trial orders with small quantities, bulk orders and customized formulas, providing one-stop solutions for foreign trade supply and private customization needs.


    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 1

    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 2

    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 3

    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 4


     

      Our Advantages

     


    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 5


     

      Packaging Process:  

     


    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 6

    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 7
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 8
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 9
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 10
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 11
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 12
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 13
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 14
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 15
    Shop Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling-Detailed Image 16
    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Certificates
    • Teriparatide 99%Freeze-dried powder  In stock Minimum Order Hot Selling Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

    Location:

    Hefei, Provincia de Anhui

    Year of Establishment:

    2026

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.