 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - large image1

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image1

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image2

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image3

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image4

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling

TDS 10 Inquiries

Unit Price: Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

TianJin

Brand:

Pharma;Conutrix

Packaging:

10 vials/box

Price valid (until):

2026-06-22

Contact Supplier

 Chat Now

Anhui Ruibang Trading Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Basic Parameter Information

Full Name: Teriparatide (Recombinant Parathyroid Hormone Fragment 1–34)

Amino Acid Sequence: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Molecular Formula: C₁₈₁H₂₉₁N₅₅O₅₁S₂

Molecular Weight: 4117.82 g/mol

CAS Number: 52232-67-4

Appearance: Sterile lyophilized white powder, individually sealed in vials (main specifications: 2mg / 5mg / 10mg)

Purity: ≥98% tested by HPLC, complete COA quality certification provided with every batch

R&D Background: Teriparatide is a bioactive truncated fragment of natural human parathyroid hormone. This synthetic peptide retains all core functional segments of full-length parathyroid hormone responsible for bone tissue remodeling and mineral metabolism regulation. Lab-grade teriparatide is prepared for osteoblast cultivation, bone metabolism pathway exploration, mineral balance testing and skeletal degenerative tissue model research, widely adopted in bone cell biology, endocrinology and orthopedic pathology laboratory projects.

2. Core Mechanism of Action

Teriparatide binds specifically to parathyroid hormone receptors expressed on osteoblasts, chondrocytes and renal tissue cells to activate signal cascades governing bone turnover and mineral circulation:

Interact with receptors on bone-forming osteoblasts to stimulate cell proliferation and metabolic activity, boost the synthesis of bone matrix proteins and drive new bone matrix deposition within culture systems;

Adjust mineral transport signals in renal tissue cell samples to regulate reabsorption of calcium and phosphorus, maintaining balanced mineral concentration inside extracellular fluid environments;

Coordinate communication between osteoblast and osteoclast precursor cells to remodel bone turnover equilibrium, favoring bone formation processes over bone breakdown under standard culture conditions;

Enhance vitality and differentiation potential of cartilage progenitor cells, supporting the maintenance of structural integrity in joint tissue co-culture models;

Trigger downstream gene expression programs linked to bone matrix generation and mineral deposition, serving as a core ligand to map regulatory networks of skeletal tissue growth;

Balance intracellular mineral storage signals to relieve mineral metabolism disorder features observed in aging skeletal cell and tissue models.

3. Core Research Efficacy (For Research Laboratory Use Only)

Osteoblast Proliferation & Bone Matrix Formation Research

Core experimental probe for cultivating bone-forming cells and exploring osteogenic differentiation pathways; suitable for mineralized nodule formation and bone matrix protein quantitative detection assays.

Systemic Calcium & Phosphorus Metabolic Balance Research

Key raw material for studying renal mineral reabsorption mechanisms, supporting cell-level analysis of mineral homeostasis and metabolic bone disorder pathways.

Bone Turnover Remodeling Mechanism Research

Adjust the balance between bone generation and bone resorption signals, applied to tissue model experiments simulating low bone mass and skeletal degenerative changes.

Chondrocyte & Joint Tissue Function Maintenance Research

Sustain normal proliferative and synthetic activity of cartilage precursor cells, auxiliary reagent for long-term joint tissue co-culture and structural function observation studies.

Skeletal Aging & Degenerative Bone Lesion Exploration

Restore weakened osteogenic activity in aged bone cell models, supporting research targeting age-related bone mass loss and skeletal tissue regeneration potential.

Supplied as sterile lyophilized white powder with HPLC verified purity ≥98%, mainstream vial specifications cover 2mg, 5mg and 10mg. Each shipment includes full supporting documents including COA, MSDS and HPLC chromatogram testing records.

As a standard synthetic parathyroid hormone fragment ligand, Teriparatide functions as a primary laboratory tool to dissect core regulatory networks governing mammalian bone growth, mineral circulation and skeletal tissue remodeling. Its stable chain structure delivers steady cell permeability and reliable receptor binding activity across diverse in vitro bone, cartilage and renal cell culture systems.

It serves as essential research material for cell cultivation and tissue model experiments covering bone cell biology, osteogenic differentiation, mineral metabolism balance and age-related skeletal degenerative research.

Note: For laboratory research use only, not approved for human oral consumption or clinical therapeutic treatment.

We maintain sufficient stable stock, full sets of export certification paperwork, door-to-door double clearance logistics service with full real-time tracking available for all orders.

About us

Anhui Ruibang Trading Co., Ltd. was established with a clear mission: to simplify international trade for businesses of all sizes. We act as a bridge between manufacturers and global buyers, offering professional sourcing, quality inspection, order coordination, and logistics management.

Our team brings years of experience in cross-border trade, supplier networks, and export documentation. We understand the challenges of international business — language barriers, quality control, shipping complexities — and we solve them with a client-first approach.
At Ruibang Trading, we don’t just move goods; we build relationships. Whether you are looking for a reliable supplier, need help consolidating shipments, or want to expand your product line, we provide tailored solutions to meet your goals.
Our Commitment: Integrity, efficiency, and transparency in every transaction.

Why choose us

Our products are of reliable quality and sell well all over the world, with partners across many countries and regions. We have professional technical support and complete after-sales teams to promptly respond to all your inquiries and demands.

We always strictly control product quality, adhere to honest business principles, and prioritize quality and service. With stable product strength and thoughtful services, we sincerely welcome global customers to negotiate cooperation and achieve win-win development together.

We have been deeply engaged in the peptide industry for many years, serving as a source biotechnology factory integrating R&D, synthesis, production and sales.

We strictly follow production and quality control standards, with the whole process adopting aseptic production and independent lyophilization and packaging. Our products feature stable appearance, good solubility and high activity retention.

We support trial orders with small quantities, bulk orders and customized formulas, providing one-stop solutions for foreign trade supply and private customization needs.

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 1

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 2

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 3

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 4

Our Advantages

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 5

Packaging Process:

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 6

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 7

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 8

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 9

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 10

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 11

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 12

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 13

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 14

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 15

Shop Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling-Detailed Image 16

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

Location:
Hefei, Provincia de Anhui

Year of Establishment:
2026

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry