 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide/

Teriparatide/

10 Inquiries

Unit Price:

$130-135/G FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

上海

Brand:

Packaging:

0.05kg/box

Price valid (until):

2028-03-16

Contact Supplier

 Chat Now

Jielu Trading

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug.

It is intended strictly for research and laboratory use only.

Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

Advantage Shop Teriparatide/-Detailed Image 1

1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

Manufacturin Shop Teriparatide/-Detailed Image 3

1. Expertise in Peptide Synthesis

Extensive Experience: 7 Years of expertise in synthetic peptide development.

Skilled Team: Experts in solid-phase and liquid-phase synthesis.

2. Advanced Manufacturing Capabilities

Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

3. Innovation & Customer Commitment

Reliable Supply Chain: Competitive pricing & timely global delivery.

Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

Global Service

Who We Serve

-We proudly work with clients across North America, Europe, Asia, and Latin America, including:

-Biotech and pharma firms

-Research institutions & universities

-Peptide formulation startups

-CDMOs and CRO partners

Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.

1. Superior Product Quality

Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

Each batch includes a Certificate of Analysis (COA) with key data:
• Purity (HPLC)
• Molecular weight (MS)
• Water content
• Residual solvents
• Microbial limit (if applicable)

For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.

2. Customization & R&D Support

We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

Our services include:
• Custom peptide synthesis (mg to kg scale)
• Peptide modifications and labeling
• Small molecule synthesis
• Project-based research and scale-up

We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

3. Wide Product Portfolio

We supply a comprehensive and expanding product range:
• Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
• Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
• Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

Items	Specifications
vial	mg
tude	g
bag	kg

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Peptide

Location:
zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

Average lead Time:
15

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
5-10

Year of Establishment:
2026

Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate Peptide Supplier Best Price 5mg 10mg 15mg 60mg,whole sale price	Pharmaceutical Grade/99		Ningbo Shu You plastic Co., LTD	Inquiry
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry