Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Cagrilintide for Sale > High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - large image1
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image1
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image2
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image3
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image4
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image5
High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research buy - image6

High Purity Cagrilintide Amylin Analogue Peptide for Laboratory Research

59 Inquiries

Unit Price: Get Latest Price
CAS No.:

1415456-99-3

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

HNYH

Packaging:

10mg/vial, 10 vials/box

Price valid (until):

2026-06-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 1
    99% Purity Cagrilintide Peptide CAS 1415456-99-3 for Research Use

    Cagrilintide is a long-acting acylated amylin analogue that acts as a dual agonist at the amylin receptor (AMYR) and calcitonin receptor (CTR). It is supplied as a lyophilized powder with ≥99% purity (tested by HPLC).

    For laboratory research purposes only. Not for human or veterinary use. Not for diagnostic or therapeutic applications.

    This product is strictly manufactured under GMP-like conditions, ensuring batch-to-batch consistency and reliability. Each batch undergoes rigorous quality control, including HPLC and Mass Spectrometry analysis, to guarantee product integrity.

    Key Research Applications: Metabolic research, receptor signaling studies, and peptide-based research compound development.



    Parameter Details
    CAS No. 1415456-99-3
    Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
    Molecular Weight 4409.01 g/mol
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, at -20°C)
    Sequence {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (Disulfide bridge: Cys3-Cys8)


    Item Specification
    Product Name Cagrilintide Peptide
    CAS No. 1415456-99-3
    Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
    Molecular Weight 4409.01 g/mol
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Dosage Strengths Available 5mg, 10mg per vial (per price list: CGL5 5mg, CGL10 10mg)
    Pack Size 10 vials per box
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, stored at -20°C)
    Grade Research Grade
    Application For laboratory research use only

    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 2



    Product Advantages & Applications



    Key Advantag es

    Advantage Description
    🔬 High Purity ≥99% purity by HPLC, COA provided with each batch
    📦 In Stock Regular sizes available in stock, ships within 3-5 business days
    🧪 Strict QC Each batch tested by HPLC and Mass Spectrometry
    🎯 Customization Custom dosage, vial cap color, peptide blends available for bulk orders
    🌍 Global Shipping FedEx/DHL/special line available, free shipping on orders over $1000

    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 3


    Primary Research Applications

    • GLP-1 receptor agonist mechanism studies

    • Metabolic research and glucose regulation studies

    • Peptide-based drug development and efficacy evaluation

    • Cell signaling pathway research



    Packaging & Shipping


    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 4 Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 5 Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 6


      Product Detail  


    Packaging Structure (From Outer to Inner)

    Level Description
    Outer Packaging Standard cardboard box
    Middle Packaging Product box (branded/plain) containing a plastic box inside
    Inner Packaging Plastic box holding 10 glass vials with foam or partition protection
    Vial Clear glass vial, aluminum-plastic flip-off seal, labeled with product name, dosage, and batch number

    Each Plastic Box Contains:

    10 vials of peptide (2mg / 5mg / 10mg / 15mg / 20mg / 30mg per vial, based on your order)

    Each vial is individually sealed with label

    Foam or plastic partition to prevent vials from bumping into each other

    Shipping Methods & Delivery Time

    Shipping Method Cost Delivery Time
    Special Line / Express $40 (under 5kg) ~14 days 


    UK Special Line Same as above ~25 days (slightly delayed)
    UPS / FedEx $70 7-10 days
    Shipping Policies

    Policy Details
    Free Shipping On orders over $1000
    Remote Area Fee Some remote areas may incur an extra $35 (as determined by FedEx/UPS)
    Lead Time 3-5 business days after payment confirmation


    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 7

    Frequently Asked Questions (FAQ)

    Q1: Can I get a sample before placing an order?

    Yes, samples are available upon request. Samples are not provided for free. You will need to pay for both the sample cost and the shipping fee. The sample fee will be deducted from your bulk order payment once you proceed with a formal order.

    Q2: What payment methods do you accept?

    We accept wire transfer (T/T), PayPal, and bank transfer. You may choose the most convenient method for you.

    Q3: How and when can I receive my order after payment?

    • Small quantity orders: Shipped via international express (DHL, FedEx, UPS, etc.). Delivery time: 7-10 days after shipment.

    • Large quantity orders: Shipped by sea. Delivery time: 15-30 days depending on the destination port.

    • Special line: ~14 days delivery time (under 5kg, $40).

    Q4: Can I use my own label or packaging?

    Yes, OEM service is available for bulk orders. We can customize labels, vial dosage, vial cap color, and packaging according to your requirements. Please contact us for details.

    Q5: What is your MOQ (Minimum Order Quantity)?

    • Retail MOQ: 1 kit/dosage/item

    • Customized packaging (e.g., custom vial size, cap color): 20-50 kits/dosage/item

    Q6: Do you provide a Certificate of Analysis (COA) with each order?

    Yes, each batch comes with a COA (HPLC purity test report). Third-party testing is also available upon request.

    Q7: How should I store the peptide?

    Store at -20°C, protected from light, and keep sealed. Once reconstituted, refrigerate at 2-8°C and use within the recommended timeframe.

    Q8: What documents will be included with my shipment?

    Commercial invoice, packing list, COA, and MSDS will be included with each shipment.


    Cagrilintide is an amylin-analog, now being developed in combination with the GLP-1 agonist semaglutide to achieve sustained weight loss in persons with overweight and obesity. This drug is an investigational therapy that reduced body weight in a phase 2 trial when administered as monotherapy in participants without diabetes and with a BMI of at least 30 kg/m2 or at least 27 kg/m2 with hypertension or dyslipidaemia[1-2].

    Basic Info
    Product Name:

    Cagrilintide

    Other Name:

    Cagrilintide;Cargliptin;Caglitide;Cagrilintide acetate;Cagrilintide peptide;Cagrilintide 5mg 10mg 15mg;Cagrilintide(Acetate form);Kagliptin

    CAS No.:

    1415456-99-3

    Molecular Weight:

    0

    EC Number:

    206-141-6

    Color/Form:

    White to off-white

    Research
    Class:

    Amylin receptor (AMYR) / calcitonin receptor (CTR) agonist (long-acting amylin analog)

    Status:

    Investigational — Phase 3 (REDEFINE program, CagriSema combination)

    Mechanism:

    A novel long-acting, acylated amylin (islet amyloid polypeptide, IAPP) analog consisting of 38 amino acids. Cagrilintide activates the amylin receptor (AMYR) and calcitonin receptor (CTR), reducing food intake, delaying gastric emptying, and promoting satiety. Being developed as monotherapy and in fixed-dose combination with semaglutide (CagriSema) for obesity. Administered once weekly.

    Activity note:

    Cagrilintide is a non-selective AMYR/CTR agonist. Specific EC50 values not publicly available; functional potency is comparable to native amylin at AMYR.

    Source:

    MCE: Cagrilintide (CAS 1415456-99-3); Novo Nordisk REDEFINE program.

    Clinical Development:

    NCT05249895; NCT05249882

    References
    PubChem:

    PubChem

    Disclaimer:

    Cagrilintide is NOT FDA-approved or EMA-approved. It is in Phase 3 clinical trials (REDEFINE program). This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    Lobby of Area B, Area E, Area F and Area G (Central Office Area), Landao Research Center, No.3 Yingbin Road, Yangpu Economic Development Zone, Hainan Province

    Payment Terms:

    TT against copy of documents,D/P

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Certifications:

    Retatrutide,Retatrutide,Retatrutide,Retatrutide

  • Inquiry History
    59 Inquiries
    Country Product Purchase Quantity Date Posted
    United Kingdom

    Cagrilintide

    10 MG Jul 31, 2026
    France

    Cagrilintide

    10 MG May 22, 2026
    Australia

    Cagrilintide

    4 MT Mar 9, 2026
    United States

    Cagrilintide

    15 MG Feb 25, 2026
    United States

    Cagrilintide

    10 PCS Dec 27, 2025
    United States

    Cagrilintide

    2 MT Dec 21, 2025
    United States

    Cagrilintide

    100 MG Oct 28, 2025
    United States

    cagrilintide

    2 MT Aug 8, 2025
    Philippines

    Retatrutide

    5 MG Aug 5, 2025
    China

    Cagrilintide

    100 G May 6, 2025
    United States

    cagrilintide

    5 MG Feb 18, 2025
    United States

    Cagrilintide

    3 MT Feb 7, 2025
    United States

    Cagrilintide

    100  Nov 12, 2024
    United States

    Cagrillintide Lyophilized powder

    100 MG Jul 4, 2024
    United States

    Cagrillintide Lyophilized powder

    1000 MG Apr 20, 2024
    United States

    Cagrlintide

    1 MT Jul 31, 2026
    United Kingdom

    cagrilintrude

    20 MG Jul 21, 2026
    United States

    Cagrilintide

    1 KG Jul 17, 2026
    United States

    Cagrilintide

    30 MG May 26, 2026
    United Kingdom

    CAGRILLINTED

    10  May 3, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.