 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg buy - large image1

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg buy - image1

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg buy - image2

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg buy - image3

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg buy - image4

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg

TDS

Unit Price:

$2.3-2.7/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONG KONG

Brand:

Peptide

Packaging:

5mg/10 bottles per box

Price valid (until):

2026-07-01

Contact Supplier

 Chat Now

Guangzhou Duo Run Trading

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

 Visit Store

Product Description
Seller Information
History Price

Description

Name：Lucy

Whatsapp:+85247161670

Whatsapp:+8613180088146

telegram:@Lucy161670

Maibox:Haha161670@outlook.com

Shop TR NAD DS LL37 Pharmaceutical Grade Peptide ll37 Powder 5mg 375-Detailed Image 1

Items	Specifications
Product Name	LL-37
CAS	154947-66-7
Molecular Formula	C205H340N60O53
color	White
Form	Solid freeze-dried powder
Storage condition	-20°C
Purity	99%
Packaging	Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)
Trademark	Customzied accepted

Shop Chinese warehouse - Fast delivery Best Price Pancragen PA20-Detailed Image 2

Peptide

Peptide products offer diverse functional benefits across multiple scenarios:

in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses;

in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity;

in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 2

Why Choose Our Peptides?

Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root
causes for lasting impact .

Key Search Terms:

Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom

peptides formulations, GLP-1 related peptides, peptide for weight management, peptide supplements for metabolic health

Customizable peptide, Skin care peptide, Beauty peptide , Muscle building peptide ,Hair growth peptide , Fitness peptide

Shop Chinese warehouse - Fast delivery Best Price Pancragen PA20-Detailed Image 6

Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 9

Physical and chemical properties:

It has many excellent properties: high purity, light color, low viscosity, good processing properties, low volatility, low toxicity, low solidifying point, durable at room temperature and so on.

These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug.

It is intended strictly for research and laboratory use only.

Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

Shop Chinese warehouse - Fast delivery Best Price Pancragen PA20-Detailed Image 8

Hazard Identification

Classification of the substance or mixture

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Shop Chinese warehouse - Fast delivery Best Price Pancragen PA20-Detailed Image 10

FAQ

Q1: About the after-sale service

A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

Q2: Do you have stock?

A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.

Q3: How do I start paying?

Payment can be made by Bitcoin,wire transfer or paypal

Q4: How to confirm product quality before placing an order?

A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

You can send us your product specifications and requirements and we can customize for you.

Q5: What is your MOQ?

A: The minimum quantity we can order is 1 box.

But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

Q6: Time for delivery?

A: Leading time within 3 business days,Shipping time about 8-10 business days.

Q7: Why should I choose you?

A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 13

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

Location:
Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
5-10

Year of Establishment:
2026
Weekly Price

 The chart shows the price trend of the product in the past 12 months.
Country Product Purchase Quantity Date Posted

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 high purity 99% freeze dried powder cas154947-66-7 senwayer hot sales	Pharmaceutical Grade/99	$85/MT FOB	Changsha Caoquan	Inquiry
High Purity LL-37 Synthetic Polypeptide Lyophilized Powder Research Grade Biochemical Material for Laboratory Research	Pharmaceutical Grade/99	$95-96/BOU FOB	HONG KONG BURSON POLYPEPTIDE R&D LIMITED	Inquiry
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices	Pharmaceutical Grade/99	$85-99/UNIT FOB	Jielu Trading	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

TR NAD DS LL37 Retatrutide Pharmaceutical Grade Peptide ll37 Powder 5mg

Product Description

Seller Information

History Price

Why Choose Our Peptides?

Key Search Terms:

Classification of the substance or mixture

More Choices Find All Products for Sale 

Related Searches