Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - large image1
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image1
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image2
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image3
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image4
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image5
Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price buy - image6

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price

TDS 10 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

香港

Brand:

STTY

Packaging:

10 mg/vial,10vial/kit

Price valid (until):

2026-07-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    We produce various peptides. Please feel free to inquire.

    WhatsApp:+852 6564 4944

    Email:1491037192@qq.com


      Main Function 


    Items Specifications
    Brand Synpeptide
    Product Name Teriparatide acetate
    CAS No.
    MF C172H278N52O47S2
    MW 3890.49792
    Melting point >205oC (dec.)
    Storage temp −20°C
    Appearance White powder
    Grade Pharmacy Grade
    Application Pharmaceutical Intermediate


    Items Specifications
    Product Name Teriparatide
    CAS Number 52232-67-4
    Appearance White Powder
    CAS 910463-68-2 Semaglutide
    CAS 2023788-19-2 Tirzepatide
    CAS 2381089-83-2 Retatrutide
    CAS 1401708-83-5 Dihexa
    CAS 121062-08-6 MTII, Melanotan II
    CAS 307297-39-8  
    Teriparatide is used to treat bone loss ( osteoporosis) in people who have a high risk of getting fractures. It is similar to a natural hormone in your body ( parathyroid hormone). It works by increasing bone mass and strength. This effect helps to decrease the risk of getting a fracture.This medication is not recommended for use in children or young adults whose bones are still growing.


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 1


      Product Detail  


    Shop mt1 10mg raw powder Melanotan 1 senwayer Factory price-Detailed Image 2

      Welcome to contact me!

    • We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

      1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

      2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.


      Product Detail  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 2

    Under ideal, controlled conditions, Adipotide once showed promising advantages:

    1. Highly Targeted and Direct:​ Unlike general weight-loss drugs that work systemically by suppressing appetite or boosting metabolism, it directly "destroys" the fat tissue itself, theoretically making it more efficient.

    2. Potentially Fast-Acting:​ In monkey studies, significant body fat reduction was observed within weeks.


      Product Detail  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 3 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 4 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 5 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 6 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 7


      Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

         I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.


    Corporate Culture:Strive for survival by quality, strive for development by competition


    Corporate Philosophy:We always adhere to "integrity-based, customer first, high quality and efficiency" as the concept, based on "excellent quality, transparent price, punctual delivery, professional service" as the principle, meanwhile we can and will do our best to provide customers with the best service to repay customers.


      Packaging Process:   


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 8


      FQA  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 9

    Samaglutide Product Introduction

    I. Basic Information
    Name: Samaglutide
    CAS No.: 910463-68-2
    Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
    Molecular Weight: 4113.58 Da
    Structure: Long-acting GLP-1 receptor agonist, fatty acid modified, half-life approximately 7 days

    Appearance: White lyophilized powder
    Purity: ≥99% (HPLC-MS)

    II. Mechanism of Action (GLP-1 monoreceptor agonist)
    Glucose Control: Glucose-dependent insulinotropic effect, glucagon inhibition
    Weight Loss: Delays gastric emptying, potent appetite suppression, reduces calorie intake
    Cardiovascular Protection: Reduces the risk of major adverse cardiovascular events 

    III. Core Efficacy
    Weight Loss 
    STEP 1: Average weight loss over 68 weeks 14–15% (approximately 15.5 kg)

    Over 80% fat loss, muscle preservation

    Blood sugar reduction 

    Type 2 diabetes: HbA1c reduction of 1.5–2.0%

    Improved metabolism

    Benefits include lowering blood pressure, improving blood lipids, and reducing fatty liver

    Cardiovascular benefits

    SELECT trial: 20% reduction in MACE risk in overweight/obese individuals

    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 10


      Handling and Storage  


    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Certificates

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    11

    Year of Establishment:

    2025

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.