 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - large image1

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image1

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image2

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image3

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image4

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price

Name: Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price
Brand: HUANGXIN
SKU: pr2607032010
Price: 40 USD
Availability: InStock

TDS 10 Inquiries

Unit Price:

$40/UNIT FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

HUANGXIN

Packaging:

10vials/box

Price valid (until):

2027-01-01

Contact Supplier

 Chat Now

Yiwu Huangxin Trading Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Polypeptide product

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Product Detail

- Teriparatide
- mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.
- Biological Activity
  ParathyroidHormone(1-34),bovine is a potent parathyroid hormone (PTH) receptor agonist. ParathyroidHorChemicalbookmone(1-34),bovine increases calcium and inorganic phosphate levels. ParathyroidHormone(1-34),bovine can be used to study osteoporosis.

Product Name	Teriparatide :
CAS	12583-68-5
Molecular Formula	C183H288N54O50S2
Molecular weight	4108.71
Purity	99%
Storage condition	Store at -20℃

Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 1

Company profile

First Chems Co., LTD is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.

Packing and Shipping

Our Advandage

1.High quality --Coming from good materials and high technology.
2.Lower price--Not cheapest but the lowest at the same quality.
3.Good service--Satisfactory service before and after sale.4.We have our own warehouses in Australia, the United States, Germany, Canada and other countries, which greatly saves shipping time and customers can receive their packages faster. In addition, customers can also choose door-to-door pickup service.

FAQ

Q: How to order this product?
A: You can click "contact now" , and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.
Q: How long can I receive my ordered goods?
A: We ship by express door to door; you can receive it in 7-10 days.
Q: What liquid should I add into the vial? And how much liquid needed?
A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.
Q: Will I have any side effects after using peptide?
A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.
Q: How to store it?
A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

Basic Info

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Polypeptide product

Location:
Unit 2, Building 141, Lane 23, Dongliantang Village, Yiwu City, Jinhua City, Zhejiang Province, Room 305

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
366

Total Annual Revenue:
$2.5 million-$5 million

Total Employees:
11-50

Year of Establishment:
2026

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry