Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - large image1
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image1
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image2
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image3
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image4
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image5
Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price buy - image6

Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price

TDS 10 Inquiries

Unit Price:

$40/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

HUANGXIN

Packaging:

10vials/box

Price valid (until):

2027-01-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide product

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    • Description


       

        Product Detail   

        Product Detail  


        • Teriparatide 
        • mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.
        • Biological Activity
          ParathyroidHormone(1-34),bovine is a potent parathyroid hormone (PTH) receptor agonist. ParathyroidHorChemicalbookmone(1-34),bovine increases calcium and inorganic phosphate levels. ParathyroidHormone(1-34),bovine can be used to study osteoporosis.
      • Product Name
        • Teriparatide :
        CAS  12583-68-5
        Molecular Formula C183H288N54O50S2
        Molecular weight  4108.71
        Purity     99%
        Storage condition 

        Store at -20℃

      .

      Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 1 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 2 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 3 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 4 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 5 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 6 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 7 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 8





      Company profile

      Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 2

      First Chems Co., LTD is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
      We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
      Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.


      Packing and Shipping

      Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 3 Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 4

      Our Advandage

      1.High quality --Coming from good materials and high technology.                  
      2.Lower price--Not cheapest but the lowest at the same quality.                  
      3.Good service--Satisfactory service before and after sale.4.We have our own warehouses in Australia, the United States, Germany, Canada and other countries, which greatly saves shipping time and customers can receive their packages faster. In addition, customers can also choose door-to-door pickup service.

      FAQ
      Q: How to order this product?
      A: You can click "contact now" , and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.
      Q: How long can I receive my ordered goods?
      A: We ship by express door to door; you can receive it in 7-10 days.
      Q: What liquid should I add into the vial? And how much liquid needed?
      A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.
      Q: Will I have any side effects after using peptide?
      A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.
      Q: How to store it?
      A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.


      Basic Info
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    Factory-Direct Source High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Factory-Direct Source  High Quality Lyophilized Powder Customs Made Peptides CAS NO.12583-68-5 Teriparatide with best price Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide product

    Location:

    Unit 2, Building 141, Lane 23, Dongliantang Village, Yiwu City, Jinhua City, Zhejiang Province, Room 305

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    366

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.