Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 |high purity more than 99% safe delivery about 15 days from china
LL37 |high purity more than 99% safe delivery about 15 days from china buy - large image1
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image1
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image2
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image3
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image4
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image5
LL37 |high purity more than 99% safe delivery about 15 days from china buy - image6

LL37 |high purity more than 99% safe delivery about 15 days from china

1 Inquiries

Unit Price:

$1/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

box

Price valid (until):

2028-01-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp:+85293764717


    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 2 Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 3

    Shop Lipo-C factory  ship china high purity-Detailed Image 3

    Shop Testagen TG20 safe delivery with door to door delivery from china-Detailed Image 4

    Shop Testagen TG20 safe delivery with door to door delivery from china-Detailed Image 5 Shop Testagen TG20 safe delivery with door to door delivery from china-Detailed Image 6 Shop Testagen TG20 safe delivery with door to door delivery from china-Detailed Image 7

       About US

     


    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 7

    Shop Lipo-C factory  ship china high purity-Detailed Image 6

    Shop Lipo-C factory  ship china high purity-Detailed Image 7

    Package & Delivery

     


    Product Packing:10mg/10vial;20mg/10vials;30mg/10vials;60mg/10vials

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place

    • Avoid repeated freezing and thawing of peptide

    • Avoid overexposure to the air • Avoid light exposure

    • Avoid storing peptides in solution long term

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 10

      FAQ 

    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price. 

    Q4: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q5: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.

    Items Specifications
    product LL37
    purity 99%
    appearance powder

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.