 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Research Grade LL37 99% freeze dried powder cas154947-66-7

Research Grade LL37 99% freeze dried powder cas154947-66-7 buy - large image1

Research Grade LL37 99% freeze dried powder cas154947-66-7 buy - image1

Research Grade LL37 99% freeze dried powder cas154947-66-7 buy - image2

Research Grade LL37 99% freeze dried powder cas154947-66-7 buy - image3

Research Grade LL37 99% freeze dried powder cas154947-66-7 buy - image4

Research Grade LL37 99% freeze dried powder cas154947-66-7

Name: Research Grade LL37 99% freeze dried powder cas154947-66-7
Brand: Henghua
SKU: pr2608042720
Price: 12 USD
Availability: InStock

3 Inquiries

Unit Price:

$12-15/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

tianjin

Brand:

Henghua

Packaging:

10vials/box

Price valid (until):

2026-09-04

Contact Supplier

 Chat Now

NBHH Technology for Pharmaceutical Inte

Company Type:

Trader

Location:

China

Qualification:

Main Products:

S3,14 bd0

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 1

Products Name: LL-37
Chemical Name: LL-37 Antibacterial Protein
CAS No: 597562-32-8
Molecular Formula: C205H341N61O52
Molecular Weight: 4492.28g/mol
Purity: >98.0%
Application: Antibacterial peptide
Appearance: White Lyophilized powder
Reconstitution: Required
Storage: After reconstitution store at 2°C - 8°C

LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 2

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 3

Packaging & Shipping

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 4

Europe	1-3days
America	1-3days
UK/Russia/Malaysia	1-3days
North America	1-3days

Air freight	1-3days
Sea transport	1-3days
Land transport	1-3days

Packaging: vacuum packaging/aluminum foil packaging/fake packaging/sealed packaging

Transportation: Sea/Air/land transportation.

Customs: 100% safe delivery, free re-delivery of any customs problems, guaranteed delivery

Our Advantages

Goods quality

1. Product has COA, and HPLC report
2. Our factory is ISO9001 standard
3. We get good feedback from customers around the world

OEM service
1. Add customer's logo
2. Redesign label, packing box as customer's requirement
3. Cap color can be customized

Shipping service
1. Goods shipped in 2-7 days after get payment.
2. Small order ship by express door to door.
3. Goods arrive in 7-20 days

24 hours on-time response
1. Reply your inquiry within 12 hours
2. Keep tracking goods and update information to custom er
3. After-sale service anytime

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 5

Feedback from customers

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 6

Company Profile

NINGBO HENGHUA TECHNOLOGY DEVELOPMENT CO., LTD. Is A PROFESSIONAL ENTERPRISE ENGAGED IN EXPORT, the products mainly include chemical products, medical devices, masks, machinery, chemical RAW materials, pharmaceutical INTERMEDIates.

We have more and more customers from all over the world. We can provide our customers with the best product quality and reasonable price. Our aim is "service and sincere exchange for your trust and support, mutual benefit and win-win". We look forward to working with friends all over the world!

In order to meet the requirements of importers and middlemen, further provide customers with "door to door" service.

We have our own export service system, can provide customers with the best export route and the lowest price.
We have a skilled, operational ability of the team.

In addition, we can find the goods with the lowest price and the best quality for overseas customers,

check the goods and reserve shipping space, so as to open up the Chinese market and relieve the import and export.

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 7

Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 8

FAQ

Q1: About the after-sale service of products
A: After purchasing the products from our factory, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

Q2: Can I get some samples?
A: Yes, we can provide samples, but the customer will pay the freight.

Q3: How do I start paying?
Payment can be made by Bitcoin,TT, L/C, DP

Q4: How to confirm product quality before placing an order?
A: You can get free samples of some products. You just have to pay the shipping fee

Q5: What is your MOQ?
A: The minimum quantity we can order is 1kit.

Q6: How to customize the product??
A:You can send us your product specifications and requirements and we will produce products according to your requirements.

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
S3,14 bd0

Location:
Room8-18,building156,No.19,26,27,QinglinCommercial Plaza,Haishu District,Ningbo City,Zhejiang Province

Payment Terms:
TT against copy of documents,L/C,100% TT in advance

Average lead Time:
7

Total Annual Revenue:
Less than $1 million

Total Employees:
11-50

Year of Establishment:
2020

Ningbo Henghua Technology Development Co., Ltd. is a company specialized in export. Our main products include pharmaceutical intermediates, food additives, chemical products, and cosmetic raw materials. These products are exported to over 80 countries and regions, including North America, Europe, Singapore, Australia, Russia, Africa, the Middle East, and more. Additionally, we offer product customization services to meet the specific needs of our clients. With a global customer base, we are able to provide the best product quality at competitive prices.

To further meet customer demands and offer "door-to-door" services, we have established our own export service system. This allows us to provide clients with optimal export routes at the lowest possible prices.

Moreover, we have a top-tier R&D team, a professional production team, and a strict quality control department, enabling us to offer overseas clients the best goods at the lowest prices, inspect products, and reserve shipping spaces, thus facilitating the expansion of the Chinese market and eliminating concerns regarding import and export. We also provide patient and attentive after-sales service to assist with any issues during the order process.

By choosing henghua, you will have a reliable partner, high-quality products, fast and secure transportation, and worry-free after-sales support. Our mission is to "earn your trust and support through service and sincerity, achieving mutual benefit and win-win outcomes." We adhere to the management principles of "Quality First, Service First, Continuous Improvement, and Innovation to Satisfy Customers," with a quality goal of "Zero Defects, Zero Complaints." Henghua Technology looks forward to cooperating with friends from all over the world!

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
VI20\| TongPeptides \| 99% Purity \|	Pharmaceutical Grade/99.5	$7/UNIT FOB	Tong peptides	Inquiry
NP810 NP810 High-quality peptides,white powder,provide home delivery service-available in stock in the warehouse,.	Pharmaceutical Grade/99	$45/G FOB	Guangzhou Changkai Trading Co., Ltd.	Inquiry
LL37 10mg Vials Epitalon CAS 307297-39-8 Peptides Supply Ghk-Cu	Pharmaceutical Grade/99	$80/UNIT FOB	Haikou Mingheng	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

Research Grade LL37 99% freeze dried powder cas154947-66-7

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches