Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - large image1
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image1
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image2
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image3
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image4
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image5
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10 buy - image6

Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10

10 Inquiries

Unit Price:

$125/MT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

Shengyufan International Trade Co., Ltd.

Packaging:

sealed foil bag

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cosmetic raw material,API,Retatrutide,Tirzepatide,Semaglutide,intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    High Purity Research Peptide Powder


    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 1


    Items Specifications
    Product name Teriparatide
    Specification 10 vials in a box
    Apperance 99%

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 2

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 3 Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 4



      About us


    We are dedicated to providing high-quality peptides at favorable prices.our products exported to over 60 countries and regions around the world, such as the United States, the European Union, the Middle East, Southeast Aisa and South America.
    At the heart of our success is our dedication to building long-term partnerships based on trust, mutual respect, and shared success. Our team of experienced sales and technical professionals works closely with customers to provide personalized solutions, from product selection and customization to technical support and after-sales service. We offer flexible ordering options, competitive pricing, and reliable delivery to ensure that our customers receive the products they need when they need them. Our global distribution network is supported by strategic partnerships with good logistics providers, allowing us to ship products efficiently and safely to destinations around the world. Whether it's a small order or a large-scale shipment, we handle every transaction with the same level of care and attention to detail.

    Constantly strive for high quality products, competitive prices, professional support, effective team, honest cooperation, safe shipment and good after-sales work. Looking forward to build long-term relationship with you.Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 5

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 6

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 7

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 8



       Package and Delivery


    Product Packing: 10 vials in a box (Customized size,label, box according to customer's requirements)

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years), after reconstitution, refrigerate at 2–8 °C (35.6–46.4 °F) and use within 2–4 weeks.

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 9

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 10

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 11



      FAQ


    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email.

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price.

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,
    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel lose.
    Our long association with our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    But in spite of our best efforts it is still possible will seize a small number of packages.
    In this circumstance we promise reship free to establish long term relationship.

    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cosmetic raw material,API,Retatrutide,Tirzepatide,Semaglutide,intermediates

    Location:

    3-1-203 Green Home, No.1 Jianming South Road, Chang'an District, Shijiazhuang City, Hebei Province

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.