Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99% white powder High purity Adamax Raw white Powder 5mg 10mg
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - large image1
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image1
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image2
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image3
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image4
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image5
Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg buy - image6

Teriparatide 99% white powder High purity Adamax Raw white Powder 5mg 10mg

TDS 10 Inquiries

Unit Price:

$35-45/UNIT EXW

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

DDP

Brand:

Pharma;Conutrix

Packaging:

10 vials/box

Price valid (until):

2026-09-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Teriparatide Acetate (hPTH 1-34)

    Basic Chemical Specifications

    • CAS No.: 52232-67-4
    • Alias: Recombinant Human Parathyroid Hormone (1–34), PTH(1-34)
    • Amino Acid Count: 34 active N-terminal residues of full-length human PTH
    • Molecular Weight: 4117.72 Da
    • Appearance: White lyophilized crystalline powder
    • Standard Vial Pack: 100mcg / 500mcg / 1mg / 2mg per sterile glass vial
    • HPLC Purity: ≥99% research grade

    Product Introduction & Core Mechanism

    Teriparatide acetate is the biologically active 1–34 fragment of endogenous human parathyroid hormone, synthesized via solid-phase peptide synthesis matching native human PTH sequence. It selectively activates PTH1 receptors expressed on osteoblasts, osteocytes and renal tubular cells, serving as the gold-standard anabolic peptide for bone metabolism research.

    A unique dual dose-dependent metabolic characteristic differentiates it from anti-resorptive bone compounds:
    1. Intermittent pulsatile administration drives net bone formation

      Short, daily transient exposure to Teriparatide preferentially stimulates osteoblast proliferation, inhibits osteoblast apoptosis, and upregulates IGF-1, FGF2 and collagen synthesis. This creates an anabolic window where bone generation outpaces bone breakdown, thickening trabecular bone, improving trabecular connectivity and increasing cortical bone mineral density.
    2. Continuous sustained exposure triggers bone resorption

      Prolonged high PTH levels activate osteoclast overactivity to dissolve bone matrix, a key control contrast widely studied in osteoporosis, bone fracture healing and age-related bone loss lab models.
    3. Calcium & phosphate homeostasis regulation

      Modulates renal calcium reabsorption and phosphate excretion, supporting research into hypocalcemia, parathyroid gland dysfunction and mineral metabolism disorders.
    4. Fracture repair & skeletal regeneration

      Promotes angiogenesis and osteogenic differentiation at sites, commonly applied in preclinical studies of delayed bone union, post-skeletal trauma recovery and senile osteopenia.

    Our Teriparatide Product Competitive Advantages

    1. Ultra-high purity ≥99%

      Every batch undergoes HPLC full purity test and LC-MS full-sequence mass spectrometry verification. Complete COA, HPLC chromatogram, heavy metal and low-endotoxin test reports (third-party Janoshik testing available) are supplied for all bulk orders; no truncated peptide fragments, oxidation impurities or sequence mismatches.
    2. Vacuum freeze-drying technology

      All moisture fully removed without preservatives to lock complete peptide biological activity. Lyophilized solid powder resists hydrolysis and oxidation during long-distance air & sea cross-border shipping, maintaining stable potency with a 24-month shelf life under proper dark cold storage.
    3. GMP clean-room sterile production

      Individually sealed single vial packaging to avoid cross-contamination. Custom private labels, bottle sizes and bulk powder split packaging service available for global lab suppliers and bone research distributors.
    4. Stable water solubility

      Rapidly dissolves in sterile bacteriostatic water to form clear, colorless sediment-free solution, ideal for precise low-dose preparation for in vitro cell culture and in vivo animal trials.
    5. Complete professional technical support

      We supply detailed reconstitution guide, temperature storage rules, laboratory dosage reference data and full batch traceability documents for all partners.

    Storage & Reconstitution Instructions

    • Unopened lyophilized powder: Long-term storage at -20°C away from light and humidity, shelf life up to 24 months; short transit storage at 2–8°C is acceptable.
    • Recommended solvent: Sterile bacteriostatic water
    • Operation tip: Equilibrate vial to room temperature before opening; slowly inject solvent along the inner vial wall and swirl gently. Violent shaking triggers peptide aggregation and irreversible activity loss.
    • Reconstituted liquid: Seal tightly and refrigerate at 2–8°C, finish all usage within 28 days; avoid repeated freeze-thaw cycles to prevent structural degradation.

    Global Wholesale Cooperation Support

    • Flexible minimum order quantity & tiered large-volume discount for stable VIP long-term partners
    • Low-risk dedicated shipping lines for USA, EU, Brazil, Australia with reduced customs detention probability
    • Exclusive one-on-one VIP account manager, fast working-hour response and professional reshipping solutions for logistics issues


    Teriparatide Acetate (PTH 1-34) Lyophilized Peptide | 99% High Purity Bone Anabolic Research Peptide

    Active fragment of human parathyroid hormone, classic anabolic agent for skeletal metabolism study.

    Core research directions: boost osteoblast activity & bone mineral density, osteoporosis & osteopenia research, accelerate bone fracture repair, regulate calcium-phosphate balance and parathyroid endocrine mechanism testing. Intermittent dosing produces robust bone-building effects unmatched by anti-resorptive peptides.

    ✅ Purity ≥99% verified by HPLC & full mass spectrometry sequencing

    ✅ Available specs: 100mcg / 500mcg / 1mg / 2mg per sterile vial

    ✅ Full set of official COA test documents attached for every batch

    ✅ Freeze-dried stable powder suitable for worldwide cross-border delivery

    ✅ Clear transparent solution after reconstitution, simple lab operation

    ✅ Custom packaging & competitive bulk wholesale pricing
    Items Specifications
    Purity  ≥99% verified by HPLC & full mass spectrometry sequencing
    Storage  at -20°C away from light and humidity, shelf life up to 24 months
    CAS No 52232-67-4


     About us 


            Anhui Ruibang Trading Co., Ltd. was established with a clear mission: to simplify international trade for businesses of all sizes. We act as a bridge between manufacturers and global buyers, offering professional sourcing, quality inspection, order coordination, and logistics management.
             Our team brings years of experience in cross-border trade, supplier networks, and export documentation. We understand the challenges of international business — language barriers, quality control, shipping complexities — and we solve them with a client-first approach.
           At Ruibang Trading, we don’t just move goods; we build relationships. Whether you are looking for a reliable supplier, need help consolidating shipments, or want to expand your product line, we provide tailored solutions to meet your goals.
             Our Commitment: Integrity, efficiency, and transparency in every transaction.


      Why choose us  


              Our products are of reliable quality and sell well all over the world, with partners across many countries and regions. We have professional technical support and complete after-sales teams to promptly respond to all your inquiries and demands.

               We always strictly control product quality, adhere to honest business principles, and prioritize quality and service. With stable product strength and thoughtful services, we sincerely welcome global customers to negotiate cooperation and achieve win-win development together.

               We have been deeply engaged in the peptide industry for many years, serving as a source biotechnology factory integrating R&D, synthesis, production and sales.

              We strictly follow production and quality control standards, with the whole process adopting aseptic production and independent lyophilization and packaging. Our products feature stable appearance, good solubility and high activity retention.

              We support trial orders with small quantities, bulk orders and customized formulas, providing one-stop solutions for foreign trade supply and private customization needs.
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 1
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 2
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 3

    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 4
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 5
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 6
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 7
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 8
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 9
    Shop Low price Teriparatide White powder High Quality tirzepatide weight loss-Detailed Image 10
    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Certificates
    • Teriparatide 99% white powder  High purity Adamax Raw white Powder 5mg 10mg Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

    Location:

    Hefei, Provincia de Anhui

    Year of Establishment:

    2026

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.