LL-37!

LL-37 (Human Cathelicidin Antimicrobial Peptide)

LL-37 is a human endogenous antimicrobial peptide and the only known member of the cathelicidin family expressed in humans. Composed of 37 amino acid residues (sequence: [LL-37, 37 aa]), LL-37 is cleaved from its precursor hCAP18 and plays a key role in innate immune defense.

Product Features:

• Appearance: White lyophilized powder
• Purity: ≥99.0% (HPLC)
• Form: Packed in glass vials 
• Storage: -20°C, protected from light and moisture

Research Areas: LL-37 has been widely studied in the following research fields:

• Innate immune response and host defense
• Antimicrobial activity against bacteria, fungi and enveloped viruses
• Wound healing and tissue repair research
• Inflammatory response regulation
• Cell proliferation and angiogenesis studies

Company Advantages:

• In-house R&D laboratory in Shenzhen, China
• Solid-phase peptide synthesis (SPPS) with strict QC control
• Each batch released with COA, HPLC and MS reports
• Small-scale trial orders and bulk production both available
• DDP shipping to most destinations worldwide

Applications: This product is supplied as a raw material / API for research and manufacturing use only. Suitable for academic research, pharmaceutical development, and cosmetic ingredient development.

For research and manufacturing use only, not for human use.