On ECHEMI

Shanghai huayi bio-lab Co.,Ltd.

Shanghai,China
Favorite Supplier
 662 people visit

Company Profile

Shanghai Huayi Bio-Lab Co.,Ltd.was established in 1999 and is the subsidiary company of Shanghai Huayi Group.Its most popular product is Vitamin B2(Riboflavin).

VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

1,3-Dihydroxy-2-propanone

2-Propanone,1,3-dihydroxy-;1,3-Dihydroxy-2-propanone;Chromelin;1,3-Dihydroxyacetone;Dihydroxyacetone;Triulose;Dihyxal;Otan;Oxantin;Oxatone;Soleal;Viticolor;α,α′-Dihydroxyacetone;Bis(hydroxymethyl) ketone;NSC 24343
96-26-4 Inquiry

2-Chloropropionic acid

Propanoic acid,2-chloro-;Propionic acid,2-chloro-;Propionic acid,α-chloro-;2-Chloropropanoic acid;2-Chloropropionic acid;α-Chloropropionic acid;DL-2-Chloropropionic acid;(RS)-2-Chloropropionic acid;(±)-α-Chloropropanoic acid;(±)-2-Chloropropionic acid;(RS)-α-Chloropropionic acid;(±)-2-Chloropropanoic acid;NSC 173;NSC 401806;(RS)-2-Chloropropanoic acid;62138-52-7
598-78-7 Inquiry

Glucagon-like peptide-1

HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2;GLP-1 [7-36];GLP-1 (7-36) AMIDE (HUMAN);GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;GLP-1 (HUMAN, 7-36 AMIDE) (BOVINE, CANINE, RAT, GUINEA PIG);GLUCAGON-LIKE PEPTIDE-1 [7-36]
107444-51-9 Inquiry

L(+)-Ascorbic acid

L-Ascorbic acid;Allercorb;Antiscorbic vitamin;Antiscorbutic vitamin;Ascorbajen;Ascorin;Ascorteal;Ascorvit;Cantan;Cantaxin;Catavin C;Cebicure;Cebione;Cecon;Cegiolan;Ceglion;Celin;Ce-Mi-Lin;Cenetone;Cereon;Cergona;Cescorbat;Cetemican;Cevalin;Cevatine;Cevex;Cevimin;Ce-Vi-Sol;Cevitamic acid;Cevitamin;Cevitan;Cevitex;Ciamin;Cipca;Concemin;Davitamon C;3-keto-L-Gulofuranolactone;L-3-Keto-threo-hexuronic acid lactone;Laroscorbine;Lemascorb;Liqui-Cee;3-Oxo-L-gulofuranolactone;Planavit C;Proscorbin;C-Quin;Ribena;Secorbate;Vicelat;Vicin;Vitacimin;Vitacin;Vitamin C;Vitamisin;Vitascorbol;Redoxon;Vitacee;L-threo-Hex-2-enonic acid,γ-lactone;Ascorbic acid;L-Lyxoascorbic acid;Xyloascorbic acid,L-;Cevital;L-Xyloascorbic acid;C-Vimin;Testascorbic;Adenex;Hybrin;Cetamid;Colascor;Scorbu C;Xitix;Celaskon;Cebion;Cemagyl;Ascorbutina;Viforcit;Vitace;IDO-C;Viscorin;Ascoltin;Hicee;Neo-Valdrin;(+)-Ascorbic acid;Citrovit;Chewcee;L-threo-Ascorbic acid;Ronotec 100;L-(+)-Ascorbic acid;Rontex 100;Juvamine;Rovimix C;Vasc;P 1110;VC 97;Kangbingfeng;Suncoat VC 40;Viscorin 100M;Cewin;Ceklin;Ascorbicap;Cetane;Cetane-Caps TC;Cetebe;E 300;NSC 218455;NSC 33832;Cell C;Ascorell;C-L 6/PW;VC 40;100M;Cinal;Rovimix C-EC;Vitashure 160;Cevarol;Tanvimil C;Vaginorm-C;Monovitan C;Pascorbin;Ascorbalox;Energil C;Bovi-C;Emvit-C;Novasol Cof;5-(1,2-Dihydroxyethyl)-3,4-dihydroxy-5H-furan-2-one;14536-17-5;30208-61-8;50976-75-5;56172-55-5;56533-05-2;57304-74-2;57606-40-3;88845-26-5;89924-69-6;129940-97-2;154170-90-8;259133-78-3;623158-95-2;882690-91-7;884381-69-5;885512-24-3;896436-13-8;1018124-03-2;1129294-89-8;1428525-25-0;1703051-92-6
50-81-7 Inquiry

phosphoric acid

Phosphoric acid;Orthophosphoric acid;EVITs;WC-Reiniger;Sonac;Decon 4512;Kefo;3M Etching Liquid;C 134 (acid);C 434 (acid);C 134;C 434;Mikro Klene DF;K-etchant;SPA 2 (catalyst);SPA 2;TG 434;Ultra-Etch Gel;Uni-Etch;Ultraetch;Amberphos 54;HQ 54;Panavia Etching Agent;Conditioner 36;E 338;Total Etch;NSC 80804;Etchalite;Kerr Etchant;Y 11A06;Ultradent;K Etchant Gel;Acidum phosphoricum;Vococid;PC 400;SF 1;SF 1 (acid);28602-75-7;178560-73-1;959699-83-3;1021417-41-3;1053657-23-0;1196963-54-8;1643589-98-3;2055242-58-3
7664-38-2 Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

China

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.