On ECHEMI

Shenzhen READLINE Technology Co., Ltd.

Shenzhen,Guangdong,China
Favorite Supplier
 1803 people visit

Company Profile

READLINE was established in 2013. The company is headquartered in the "National Science and Technology Business Incubator" in Shenzhen Nanshan Hi-tech Industrial Park. It is an innovative group company integrating R&D, production, sales, and investment. There are three subsidiaries in the group company: Shenzhen Redline Biotechnology Co., Ltd. which focuses on the applications of immobilized enzymes technology, Shenzhen Redline Technology Co., Ltd. which specializes in import and export trade, and Shenzhen Redline Venture Capital Partnership (Limited Partnership) which focuses on venture capital in the medical and health field.

VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

Acetyl Hexapeptide-8

616204-22-9 Inquiry

Acetyl Octapeptide-3

N-Acetyl-L-alpha-glutamyl-L-alpha-glutamyl-L-methionyl-L-glutaminyl-L-arginyl-L-arginyl-L-alanyl-L-alpha-asparagine;SNAP-8(AcetylGlutamylHeptapeptide-3);AcetylGluChemicalbooktaMylHeptapeptide-3;AcetylOctapeptide-3;AcetylGlutaMylOctapeptide-3;AcetylOctapetpide-3;snap-8/AcetylOctapeptide-3/AcetylGlutamylHeptapeptide-3;AcetylOctapeptide-8
868844-74-0 Inquiry

Acetyl tetrapeptide-5

Acetyl tetrapeptide-5;Ac-Beta-Ala-His-Ser-His-OH;Eyeseryl;UNII-Y1DFQ308G8;Y1DFQ308G8;(3-acetamidopropanoyl)-L-histidyl-L-seryl-L-histidine;N-Acetyl-beta-alanyl-L-histidyl-L-seryl-L-histidine;(2S)-2-[[(2S)-2-[[(2S)-2-(3-acetamidopropanoylamino)-3-(1H-imidazol-5-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-5-yl)propanoic acid;9054Af;KS-00000TXI
820959-17-9 Inquiry

Acetyl Tetrapeptide-9

Acetyl tetrapeptide-9(Dermican LS 9837);N2-Acetyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidine;cetyl tetrapeptide-9/Dermican LS 9837;(3S)-3-[[(2S)-2-acetamido-5-amino-5-oxopentanoyl]amino]-4-[[(2S)-1-[[(1S)-1-carboxy-2-(1H-imidazol-5-yl)ethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-oxobutanoic acid;Acetyl Tetrapeptide-9, Dermican;L-Histidine, N2-acetyl-L-glutaminyl-L-α-aspartyl-L-valyl-;Acetyl Tetrapeptide-9 USP/EP/BP;Supply Top Quality Cosmetic Peptide Acetyl Tetrapeptide-9 Anti-Aging and Skin Smoothing CAS 928006-50-2
928006-50-2 Inquiry

Antide

-(3-pyridinylcarbonyl)-d-lysyl-l-leucyl-n(sup6)-(1-methylethyl)-l-lysyl-l-pro;3-pyridinyl)-d-alanyl-l-seryl-n(sup6)-(3-pyridinylcarbonyl)-l-lysyl-n(sup6);lyl-;ANTIDE;AC-(D-NAL)-(D-P-CL-PHE)-(D-PAL)-SER-LYS(NICOTINOYL)-[D-LYS(NICOTINOYL)]-LEU-LYS(ISOPROPYL)-PRO-[D-ALA]-NH2;AC-D-ALA(2-NAPHTHYL)-D-PHE(4-CL)-D-ALA(3'-PYRIDYL)-SER-LYS(NICOTINOYL)-D-LYS(NICOTINOYL)-LEU-LYS(ISOPROPYL)-PRO-D-ALA-NH2;AC-D-2-NAL-P-CHLORO-D-PHE-BETA-(3-PYRIDYL)-D-ALA-SER-LYS(NICOTINOYL)-D-LYS(NICOTINOYL)-LEU-LYS(ISOPROPYL)-PRO-D-ALA-NH2;Antide Acetate
112568-12-4 Inquiry

Calcitonin (Salmon)

47931-85-1 Inquiry

Copper Peptide / GHK-Cu

[N2-(N-Glycyl-L-histidyl)-L-lysinato(2-)]copper;Ghk-Cu/AHK-CU;Copper tripeptide (GHK-Cu);Prezatide copper,[N2-(N-Glycyl-L-histidyl)-L-lysinato(2-)]copper;tripeptide/GHK-Cu;Copper peptide, GHK-Cu, Copper tripeptide-1;GHK Copper;GHK.CU.HAC
89030-95-5 Inquiry

Copper Peptide(2:1, HOAc)

Prezatide copper acetate;GHK-Cu(Prezatide Copper Acetate);prezatide copper;GHK-Cu, >=98%;Copper peptide, Copper Tripeptide-3, AHK Copper
130120-57-9 Inquiry

Dipeptide diaminobutyroyl benzylamide diacetate

(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamide acetate;SYN-AKE;snake-tripeptide;H-β-Ala-Pro-Dab-NHBzl.2AcOH;SnaketrippChemicalbooketide;DipeptideDiaminobutyroylBenzylamideDiacetate;Syn-Ake,Snaketrippetide;DIPEPTIDEDIAMINOBUTYROYLBENZYLAMIDEDIACETATE/Snaketrippetide
823202-99-9 Inquiry

Dipeptide-2

L-VALYL-L-TRYPTOPHAN;H-VAL-TRP-OH;VAL-TRP;N-valyltryptophan;L-Valyl-L-tyrosine;Dipeptide Val-Try;Dipeptide-2 / Dipeptide Val-Try;VW-2
24587-37-9 Inquiry

Elcatonin

THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
57014-02-5 Inquiry

Fertirelin Acetate

Des-Gly(sup10)-gnrh-ethylamide;Fertirelinmonoacetate;Luteinizinghormonereleasingfactor(pig),9-(N-ethyl-L-prolinamide)-10-deglycinamide-,monoacetate(salt);Ovalyse;U69689E;aceticacid:(2S)-N-[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-5-(diaminomethylideneamino)-1-[(2S)-2-(ethylcarbamChemicalbookoyl)pyrrolidin-1-yl]-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]-5-oxopyrrolidine-2-carboxamide;Conceral
66002-66-2 Inquiry

Fmoc-Gly-Gly-Gly-OH

170941-79-4 Inquiry

Fmoc-Gly-Gly-OH

FMOC-GLYCYL-GLYCINE;FMOC-GLY-GLY-OH;N-[(9H-Fluoren-9-ylmethoxy)carbonyl]glycyl-glycine;N-9-Fluorenylmethoxycarbonylglycylglycine;2-(2-(((9H-fluoren-9-yl)methoxy)carbonylamino)acetamido)acetic acid;REF DUPL: Fmoc-Gly-Gly-OH;FMoc-Gly-Gly;FMoc-Gly4
35665-38-4 Inquiry

Fmoc-Lys(Boc)-OH

L-Lysine,N6-[(1,1-dimethylethoxy)carbonyl]-N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-;N6-[(1,1-Dimethylethoxy)carbonyl]-N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-lysine;Fmoc-Lys(Boc)-OH;Nα-(9-Fluorenylmethoxycarbonyl)-Nε-(tert-butoxycarbonyl)lysine;N-α-(Fmoc)-N-ε-(t-boc)-L-Lysine-OH;NSC 334302;(S)-6-[(tert-Butoxycarbonyl)amino]-2-[[[(9H-fluoren-9-yl)methoxy]carbonyl]amino]hexanoic acid;(2S)-6-(tert-Butoxycarbonylamino)-2-[[[(9H-fluoren-9-yl)methoxy]carbonyl]amino]hexanoic acid;(S)-2-[[[(9H-Fluoren-9-yl)methoxy]carbonyl]amino]-6-(tert-butoxycarbonylamino)hexanoic acid;N-α-Fluorenylmethoxycarbonyl-N-ε-tert-butoxycarbonyl-L-lysine;(2S)-2-(9H-Fluoren-9-ylmethoxycarbonylamino)-6-[(2-methylpropan-2-yl)oxycarbonylamino]hexanoic acid;618901-75-0;1202364-64-4;1414933-21-3;1884207-95-7
71989-26-9 Inquiry

Glucagon

GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
16941-32-5 Inquiry

Glutathione

Glycine,L-γ-glutamyl-L-cysteinyl-;Glutathione;Glycine,N-(N-L-γ-glutamyl-L-cysteinyl)-;L-γ-Glutamyl-L-cysteinylglycine;γ-L-Glutamyl-L-cysteinylglycine;Glutathione-SH;GSH;L-Glutathione;Reduced glutathione;Triptide;Glutide;Tathion;Tathione;Copren;Deltathione;Glutathion;Glutinal;Isethion;Neuthion;Agifutol S;γ-Glutamylcysteinylglycine;N-(N-L-γ-Glutamyl-L-cysteinyl)glycine;Bakezyme RX;ReadiSorb;Atomolan;High Thione Extract YH 15;N5-((R)-1-((Carboxymethyl)amino)-3-mercapto-1-oxopropan-2-yl)-L-glutamine;TAD 600;1109226-07-4;1655518-50-5
70-18-8 Inquiry

Hexapeptide-11

Proteins, yeast, hydrolysate;Yeast protein hydrolysate;Protein hydrolyzates, yeast;HYDROLYZED YEAST PROTEIN;Einecs 309-709-2;Hexapeptide-11/Peptamide 6 powder;Rhodamine B-5(or 6)-isothiocyanate
100684-36-4 Inquiry

Hexapeptide-9

Collaxyl
1228371-11-6 Inquiry

Histrelin Acetate

Supprelin la;Vantas;Histrelin acetate, >=98%
220810-26-4 Inquiry
  • 1
  • 2
  • Go to Page Go

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.