On ECHEMI

Euroscreen Euroscreen

Belgium
Favorite Supplier
 159 people visit

Company Profile

Euroscreen is a Belgian chemical company that specializes in the production and distribution of high-quality chemicals for a variety of industrial and commercial applications. With a focus on innovation, sustainability, and customer service, Euroscreen has become a trusted supplier to a wide range of businesses and organizations around the world.


Founded in 1999, Euroscreen is committed to sustainability and has implemented a range of policies and practices to reduce its environmental impact, including using energy-efficient production facilities and developing products that are easy to use and have minimal environmental impact.


One of Euroscreen's key strengths is the ability to work closely with customers to develop custom solutions based on their specific needs. Whether it is the development of new products, modifications to existing products, or providing customer support, Euroscreen's expert team is committed to providing the highest level of service. In addition to its focus on innovation and sustainability, Euroscreen is renowned for its reliability and consistency in delivering high-quality chemicals on time and within budget.


Euroscreen's products are designed for industrial and commercial applications, and the main markets it serves include the pharmaceutical, cosmetics, food and water treatment industries. Euroscreen's products are also used in a variety of research and development applications, including the development of new materials and testing of new products.


VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

3-Aminopropanol

1-Propanol,3-amino-;3-Amino-1-propanol;β-Alaninol;3-Aminopropanol;3-Hydroxypropylamine;Propanolamine;3-Aminopropyl alcohol;γ-Aminopropanol;1-Amino-3-propanol;3-Propanolamine;1-Amino-3-hydroxypropane;3-Hydroxy-1-propylamine;γ-Hydroxy-1-propylamine;1,3-Propanolamine;3-Hydroxy-1-aminopropane;NSC 7766;N-(3-Hydroxypropyl)amine;3-Hydroxypropan-1-amine;3-Aminopropan-1-ol
156-87-6 Inquiry

Adenosine

Adenosine;Adenine riboside;9-β-D-Ribofuranosyladenine;β-D-Adenosine;9H-Purin-6-amine,9-β-D-ribofuranosyl-;β-D-Ribofuranose,1-(6-amino-9H-purin-9-yl)-1-deoxy-;β-D-Ribofuranoside,adenine-9;β-Adenosine;Boniton;Myocol;Nucleocardyl;Sandesin;Riboadenosine;9-β-D-Ribofuranosyl-9H-purin-6-amine;D-Adenosine;Adenocard;Adenoscan;Adrekar;Adenocor;NSC 7652;24: PN: WO2007053194 SEQID: 49 claimed sequence;26: PN: WO2007053194 SEQID: 49 claimed sequence;27: PN: WO2007053194 SEQID: 49 claimed sequence;Adenogesic;NQZ-012;46946-45-6;46969-16-8
58-61-7 Inquiry

Adrenomedullin (human)

H-TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2;H-TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2 (DISULFIDE BRIDGE: 16-21);ADM 1-52, HUMAN;ADRENOMEDULLIN (HUMAN);ADRENOMEDULLIN 1-52, HUMAN;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (DISULFIDE BRIDGE: 16-21);TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2;humanadrenomedullin
148498-78-6 Inquiry

Angiotensin

Angiotensin;Angiotonin;Angiotensins;1405-70-5;12642-17-0
1407-47-2 Inquiry

Bombesin

2-l-glutamine-6-l-asparagine-alytesi;bombesin acetate;Bombesin, Free Base;BOMBESIN SYNTHETIC >97% STIMULATES GASTR IN RE;Bombesinhydrateacetatesalt;M.W. 1619.85C71H110N24O18S;5-Oxo-L-Pro-L-Gln-L-Arg-L-Leu-Gly-L-Asn-L-Gln-L-Trp-L-Ala-L-Val-Gly-L-His-L-Leu-L-Met-NH2;Bombesin acetate salt hydrate
31362-50-2 Inquiry

Bradykinin

bk;brs640;prs640;C00306;RPPGFSPFR;BRADYZIDE;Callideic;KallidinⅠ;BRADYKININ;CallidinI
58-82-2 Inquiry

Cholecystokinin

CCK;CHOLECYSTOKININ;PANCREOZYMIN;pancreozymin from porcine intestine;PANCREOZYMIN (CHOLECYSTOKININ) SOURCE SPECIES: PORCINE INTESTINE ACTIVITY: APPROX. 2-4 CRICK UNITS PER MG SOLID;Intestineactivityapprox.2-4crickU/mgsolid,sourcespecies:porcine;Pancreozymin=cholecystokinin;CHOLECYSTOKININE
9011-97-6 Inquiry

Dopamine

1,2-Benzenediol,4-(2-aminoethyl)-;Pyrocatechol,4-(2-aminoethyl)-;4-(2-Aminoethyl)-1,2-benzenediol;4-(2-Aminoethyl)pyrocatechol;DA;3,4-Dihydroxyphenethylamine;3,4-Dihydroxyphenylethylamine;Dopamine;3-Hydroxytyramine;Oxytyramine;2-(3,4-Dihydroxyphenyl)ethylamine;α-(3,4-Dihydroxyphenyl)-β-aminoethane;Dopamin;Hydroxytyramin;4-(2-Aminoethyl)catechol;Dophamine;NSC 173182;2-(3,4-Dihydroxyphenyl)-1-ethanamine;Duobaan
51-61-6 Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.