Product
Supplier
Encyclopedia
Inquiry
Home > BETA-AMYLOID (1-43) for Sale > Amyloid β-Protein (1-43)
Amyloid β-Protein (1-43) buy - large image1
Amyloid β-Protein (1-43) buy - image1

Amyloid β-Protein (1-43)

Unit Price: Get Latest Price
CAS No.:

134500-80-4

Grade:

Research grade

Port:

SHANGHAI

Packaging:

0.001kg/Bottle

Price valid (until):

2020-12-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Pharmaceutical Peptide,Cosmetic peptide,Custom peptides,API polypeptide,Amino acids and derivatives,Peptide - Teriparatide

  • Product Description

  • Seller Information

  • Description

    Product Name:Amyloid β-Protein (1-43)

    Synonyms:β-Amyloid (1-43)Amyloid β-protein fragment 1-43

    CAS No.:134500-80-4

    Catalog No.:GT-P011

    Key Specification:

    Appearance:  White powder
    Purity (HPLC) ≥95.0%

    Single impurity≤2.0%

    Peptide content≥80.0%

    Package:

    Vacuum-packed with aluminum foil bag or transparent bag. 10mg,50mg, 100mg,1g,10g, 50g per package with icebag. Or according to your request. 

    Product Detail

    Amyloid β - protein (1-43) is one of the longest sequences in β - Amyloid protein series.This kind of long peptide will be more difficult in solid-phase synthesis.

    The main difficulty is the difficulty of sequence synthesis and the folding with the extension of peptide chain. At the same time, the water-soluble property ofAmyloid β - protein (1-43) is not good, which undoubtedly brings difficulties to the later purification, so Amyloid β - protein (1-43) is more expensive in the market.Due to the difficulty of sequencing peptide, Go Top Peptide Biotech has special researchers in charge of production, with a high success rate.

     

    Go Top Peptide Biotech has a special researcher who is responsible for the production of Amyloid β - protein series and has mature technology.

    Storage:Cool dry place( Store at -20°C, away from the light)

    Remark:For Research Use Only. Not for human use.

    Basic Info
    Product Name:

    BETA-AMYLOID (1-43)

    Other Name:

    BETA-AMYLOID (1-43);BETA-AMYLOID (1-43) PEPTIDE;BETA-AMYLOID PEPTIDE [1-43], HUMAN;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT;H2N-D-A-E-F-R-H-D-S-G-Y-E-V-H-H-Q-K-L-V-F-F-A-E-D-V-G-S-N-K-G-A-I-I-G-L-M-V-G-G-V-V-I-A-T-OH;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-OH;A-BETA (1-43);AMYLOID BETA-PROTEIN (1-43)

    CAS No.:

    134500-80-4

    Molecular Formula:

    C207H318N56O62S1

    Molecular Weight:

    4615.14

    Exact Mass:

    4614.324

    Characteristics
    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s) no data available
    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)
    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Pharmaceutical Peptide,Cosmetic peptide,Custom peptides,API polypeptide,Amino acids and derivatives,Peptide - Teriparatide

    Location:

    5th Floor, Building 1, No. 600 Yinhai Street, Xiasha Street

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    51-100

    Year of Establishment:

    2014

    Hangzhou Go Top Peptide Biotech , established in 2014, is a technology-based peptide company and a National High-tech Enterprise located in Hangzhou of China. It is also the governing unit of Peptide Branch of China Biochemical Pharmaceutical Industry Association. 

    The company currently has a peptide research center in Hangzhou, covering an area of 2,000m2 . There are two cooperation plants for peptide commercialization located in Shangyu and Anji of Zhejiang province.  The peptide center has equipped with several complete peptide productions lines, including several large-scale peptide synthesizers and advanced imported HPLC systems with different sizes. We also have GMP standard clean laboratories to meet client’s special needs. The company has passed ISO9001:2015 certification.

    At present, the company has developed more than 40 mature pharmaceutical peptides, with the annual production capacity up to 100 kilograms. With a total of 20,000 custom peptides so far, we can provide the one-stop peptide services from research scale (mg) - pilot scale - commercial production(KGs).


    English web site  https://www.gtpeptide.com

    Products and Services

    1.Custom peptide synthesis, such as Research peptide, Neoantigen peptide, Clinical peptide.

    2.Pharmaceutical peptide development and production.

    3.Peptide CRO and CDMO.

    4. Cosmetic peptide and formulation development.

    5. Special protected amino acids and small molecules.

    6. Commercialized peptide library.

    7. Technical support of new drug development.


    SHELLY HUDirector of sales13735575465sales1@gotopbio.com
       Cindy MeiThe sales manager13588827304sales3@gotopbio.com




  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.