LL-37, LL37, CAMP, CAP-18, 154947-66-7
3 Inquiries
154947-66-7
Reagent Grade
98%
shanghai
cellmano
1g/vial
2029-12-31
Cagrilintide,SS-31, Elamipretide,Semaglutide,Tirzepatide,Retatrutide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Basic Info
-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
Cagrilintide,SS-31, Elamipretide,Semaglutide,Tirzepatide,Retatrutide
-
Location:
Room C608, Chiyuan venture park
-
Payment Terms:
TT against copy of documents,100% TT in advance
-
Average lead Time:
10
-
Total Annual Revenue:
$5 million-$10 million
-
Total Employees:
11-50
Cellmano Biotech Limited focus on researching and developing solid phase peptide synthesis methodology since 2011. Cellmano has 10 years experience in researching, developing and manufacturing peptides by solid peptide phase synthesis.
Cellmano not only provides cosmeceuticals peptide & generic peptides to the customers, but also offer peptide CMO service and custom peptides synthesis service depend on the requirement from the customers over the world. Cellmano has state-of-the-art labs armed with excellent instrument for synthesis, purify and analysis .Cellmao control the quality by checking the materials, supervising produce process and finally QC. Cellmano keep all the synthesis records , purify methods and analysis result for every batch peptide product with staff and time invovled in the archives. Synthesizing by classical solid phase mothed invented by Prof.Bruce Merrified and purifying by HPLC instrument, Cellmano supply the customers excellent peptide products with reasonable price ,while maintain high quality, to help the customers to cut down their cost and shorten the time . Cellmano is trying her best to complement the inventory for more than 2000 popular peptide products, to make sure the customers can get what they need in one week from Cellmano’s inventory. Also to saitisfy diverse request from different customers for different projects, Cellmano provide custom synthesis for peptides from mgs to kgs with the purity from crude to 98% .
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product