Product
Supplier
Encyclopedia
Inquiry
Teriparatide API buy - large image1
Teriparatide API buy - image1

Teriparatide API

11 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

pharmaceutical grade

Content:

98%

Port:

shanghai

Brand:

sylic

Packaging:

25kg/Cardboard Drum

Price valid (until):

2024-04-12

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Dyes,Textile agent,Medical intermediate,API,Pigments,Basic Chemicals

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    1. Introduction

      Items Specifications
      Product name Teriparatide acetate
      CAS NO. 52232-67-4
      Molecular formula C172H278N52O47S2
      Applications Intermediates for organic synthesis.
      Purity 98%
      Shipping conditions conventional transport


      You can ask us for quotation and product information via Email, Phone, WhatsApp and other channels.

      Email: zoeliu@skygroupchem.com

      WhatsApp: +86 17371389751

      Phone:+86 17371389751

      Who we are


    SKYCHEM GROUP, founded in 1999, provides a wide range of products and technology exports to more than 1,000 customers in more than 60 countries, including dyes, chemical additives, and medical intermediates.There are 55 employees, all of whom have bachelor's degree or above, 13 of whom have doctor's degree or master's degree.


    In 2013, the Group established a wholly-owned subsidiary HANGZHOU CHUNGYO CHEMICALS CO., LTD. with a factory located in Fujian Province, fully equipped with commercial production capacity, providing global chemical enterprises with core services from pilot and pilot to scale-up production.



    1. Why choose us


    Quality guarantee


    Product quality management is the top priority of BidD's internal management. Through strengthening staff training, improving testing technology, improving testing indicators, and constantly improving every link in quality control, we ensure that the quality of each batch of products meets customer requirements. All along, Chungyo's business activities are carried out in strict accordance with international quality management standards, and the company has obtained the ISO9001:2015 international quality system certification from Swiss General Standards Company (SGS)


    Chungyo has a large-scale production base, can provide customers with customized production services. We strictly abide by ISO standards for product control, and employees are required to receive formal training at the beginning of entering the company's service, and regularly hold training and assessment. To ensure that all products are produced by well-trained staff following the prescribed procedures and procedures.


    Each batch of our products is accompanied by a detailed quality inspection list, including: product name, batch number, purity, production date, reinspection period, storage conditions, analysis data and other detailed data. Our guidance document is based on ICH Q7 Good Manufacturing Practice, which also provides formal induction and regular training for the company's relevant employees.


    In our quality control system, we use the following testing steps to ensure the quality of each batch of products:


    Raw material inspection
    Intermediate quality testing
    Product quality inspection
    Product Analysis and Inspection Certificate (COA)
    Keep samples for at least one year for each batch of products



    In product quality control, we use the following techniques: 


    Mass spectrometry (LMS)
    Spectral technology (infrared, ultraviolet)
    Polarimetry
    Metal content analysis
    Amino acid analysisRaw material inspection
    Elemental analysis
    Amino acid analysisRaw material inspection



    R&D Base


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 1







    LC-MS:1 Set

    LC-Solution Lite:4 set

    Agilent technologies HPLC:1 set

    Thermo Fisher CAD HPLC:1 set

    Shimadzu GC:2 set



    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 2















    R&D laboratory: 40 sets of fume hoods

    Pilot laboratory: 200 square meters

    Equipped with 6 sets of high and low temperature reaction machines (-80 degrees -200 degrees)

    Glass reactor: 30,50,100 L (4 sets)

    4 sets of hydrogenation reactors (1 L, 5 L, 25 L, 50 L)













    Production base



    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 3

    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 4


    The factory has 50 liters to 3,000 liters of reactor, equipment to meet various production conditions; The total volume of the reactor is 82m3;At present, the two workshops have been put into operation, and the total number of reaction kettle enamel kettle and stainless steel kettle is 65.


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 5


    The factory has set up physical and chemical laboratory, chromatography laboratory, sampling room/sample retention room/stability laboratory/reagent room and other areas, as well as reserved microbiology laboratory, fully meet the requirements of raw materials and finished products of the indicators of testing.


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 5


    R&D Service


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 6


    Second phase technical reform plan:


     In November 2021, it has been started, mainly in the first and second workshops, and the investment of this technical transformation is about 60 million yuan. The second phase

    The technical transformation construction drawing design has been completed in 2022, and the safety and environmental assessment work will be completed soon.

    The first and second workshops are equipped with glass lined reactors of 3000L, 4000L, 5000L, 6300L and 10000L,41 sets in total, can do chlorination, nitrification and other high-risk processes, equipped with 500L, 2000L ultra-low temperature reactor 2 sets, equipped with 500L,1000L high temperature kettle 2 sets, can meet the needs of high temperature and ultra-low temperature special reaction.

    The second phase of the technical reform will be in one workshop area, about 500 square meters of GMP workshop and its pre-treatment area will be set up separately, with 3 lines

    Independent production line, reactor specifications of 300L, 500L, a total of 6, can meet the production of 15 to 20 tons of raw materials.

    In the second phase of technical reform, three hydrogenation reactors of 500L, 1000L and 2000L will be added to the hydrogenation area of the fourth workshop.Adjust the drying area of the third workshop and add 4 sets of 2000L~3000L glass lined kettle.




    1. FAQ



    1.What's your payment terms?

    T/T、L/C or have a negotiation

    2.What's your shipping time?

    We have bulk in stock, which means we can ship it to you immediately.

    3.How do you ship the order normally?

    For large qty order,ship the goods by sea. For small qty order, by air or express. We supply optional express for you, including DHL.FEDEX.UPS.EMS and so on

    4.Do you supply samples?

    Yes,but we have to charge as it is cost to deliver abroad.


    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Dyes,Textile agent,Medical intermediate,API,Pigments,Basic Chemicals

    Location:

    Room 507, Dongnan Technology R&D Center, No.438 Jincheng Road, Beigan Street, Xiaoshan District,Hangzhou City,Zhengjiang Province,China

    Payment Terms:

    TT against copy of documents,L/C,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $25 million-$50 million

    Total Employees:

    51-100

    Year of Establishment:

    2013

    WHO WE ARE
    Hangzhou Chungyo Co., Ltd. is a wholly-owned subsidiary of skychem group.Since the company was founded in 1999.Chungyo has become one of the leading chemical product specializing in chemical product development, production and export, with an annual production capacity of 60,000 tons.
    In the course of our operation in the chemical industry, we have proved that we are a high quality export supplier. Due to the successful operation in the domestic market in the past 15 years, we will expand overseas markets from 2014. Now our auxiliary products, dyes, pharmaceutical intermediates and other products with stable quality, pure composition, efficacy, consistency and so on are widely praised.
    We will adhere to the principle of "integrity first", and domestic and foreign customers mutual benefit, hand in hand.
  • Inquiry History
    11 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.