Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > --Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - large image1
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image1
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image2
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image3
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image4
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image5
--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image6

--Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping

10 Inquiries

Unit Price:

$1/KG FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

JL

Packaging:

box

Price valid (until):

2027-08-12

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Description

    Product Detail

    We are a professional supplier specializing in chemical raw materials, GHK-Cu Copper Peptide, and related products for global customers.

    Committed to quality, service, and long term cooperation.

    Contact us today for product information and quotations. We look forward to working with you.


    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 1


      Packing & Delivery   


    Packaging
    Standard packaging includes bottle / bag.  Customized packaging is available according to customer requirements.
     
    Delivery Time
    Normally 7–15 days after order confirmation, depending on order quantity.


      Company Profile  


    We are a professional supplier of chemical raw materials with many years of experience in international trade. Our product range covers inorganic chemicals, pigments, food additives, industrial additives, and other chemical materials widely used in coatings, plastics, rubber, food processing, water treatment, and various industrial fields.


    We support bulk orders, customized packaging, OEM labeling, and sample supply to meet different market requirements. Our experienced export team ensures smooth communication, fast quotation, and efficient order processing from inquiry to shipment.

    With stable supply capacity, professional service, and long-term cooperation philosophy, we are committed to becoming a trusted partner for customers worldwide.

    We welcome partners from all over the world to contact us for product information and cooperation.
    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 2


      Service


    We are committed to providing efficient and reliable services for global customers. From product inquiry to shipment, our professional team ensures smooth communication and fast response.
    Our services include:
    • Professional product consultation
    • Fast quotation and order confirmation
    • Flexible packaging and OEM labeling
    • Sample support for product testing
    • Stable supply and timely delivery
    • Export documentation and logistics coordination
    We focus on long-term cooperation and strive to provide customers with convenient and dependable supply solutions.
    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 3


      Why Choose Us   


    • Stable supply chain and reliable factory resources
    • Strict quality control to ensure consistent product quality
    • Competitive pricing with efficient production support
    • Professional export experience and global market service
    • Flexible cooperation models for different customer needs
    We aim to build long-term partnerships by delivering quality products, dependable service, and sustainable cooperation.
    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 4


    FAQ


    How do you ensure product quality?
    All products are produced under strict quality control. We provide product specifications and inspection reports to ensure stable quality.
     
    Do you support customized packaging or OEM labeling?
    Yes, we support OEM packaging and customized labels according to customer requirements.

    For more information, please send us an inquiry or contact us directly.Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 5 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 6 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 7 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 8 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 9 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 10 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 11 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 12 Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 13



    TSM5 peptide powder



    Items Specifications
    name TA10 peptide powder
    Purity 99%
    Packaging 10mg*10vials
    price 179$

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.
    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 14

    Peptides:
    Peptides are compounds formed by connecting alpha amino acids together through peptide bonds, and are intermediate products of protein hydrolysis. A compound formed by dehydration condensation of two amino acid molecules is called a dipeptide, and similarly, there are also tripeptides, tetrapeptides, pentapeptides

    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 15

    Package & Delivery

    Product Packing: 10mg/vial 10vials/box , 15mg/vial 10vials/box, 20mg/vial 10vials/box (Customized according to customer requirements)30mg/vial 10vials/box (Customized according to customer requirements)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place

    • Avoid repeated freezing and thawing of peptide

    • Avoid overexposure to the air • Avoid light exposure

    • Avoid storing peptides in solution long term
    Shop BT5 BT10 5mg 10mg Customized Lyophilized Peptides Raw Powder peptides-Detailed Image 16

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.