Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > Glucagon for Sale > High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - large image1
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image1
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image2
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image3
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image4
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image5
High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon buy - image6

High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon

4 Inquiries

Unit Price:

$200-250/G FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

china any port

Brand:

TNJONE

Packaging:

1g,10g,50g or according to customer's detail requirement.

Price valid (until):

2026-12-30

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,API,Vitamins,Food Additive

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon


    Items Specifications
    Product Name Glucagon Acetate / Glucagon
    Cas No 16941-32-5
    Einecs 685-611-6
    MF C153H225N43O49S
    MW 3482.75
    Appearance white powder
    Density 1.53±0.1 g/cm3(Predicted)
    Shelf Life 2 Years When Properly Stored
    Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder.

    What is Glucagon ?

    Glucagon is a peptide hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the
    bloodstream. Its effect is opposite that of insu.lin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose,which is released into the bloodstream. High blood glucose levels stimulate the release of insu.lin. Insu.lin allows glucose to be taken up and used by insu.lin-dependent tissues. Thus, glucagon and insu.lin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.

    Shop High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon-Detailed Image 1 Shop High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon-Detailed Image 2



    Glucagon Acetate Function
    It is a common topical treatment for acne and can be useful against some methicillin-resistant Staphylococcus aureus (MRSA) infections. The most severe common adverse effect of clindamycin is Clostridium difficile-associated diarrhea (the most frequent cause of pseudomembranous colitis). Although this side effect occurs with almost all antibiotics, including beta-lactam antibiotics, it is classically linked to clindamycin use.

    Glucagon Acetate Dosage
    This depends on your body weight. All of the research carried out so far has used rodent studies, the rats and mice are usually injected with an effective dosage thought to be around 10 μg (mcg) per KG, in humans this is thought to be around the equivalent loading of 1.6 μg per KG in humans, so if you are: 

    Company Information 
    Shop High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon-Detailed Image 3






    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Other Chemical Drugs

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,API,Vitamins,Food Additive

    Location:

    No. 4C-11-A392, Financial Port, Northwest corner of Fengjing Avenue and Fengxin Road, Fengdong New City, Xi 'an, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2019

    Shaanxi TNJONE Pharmaceutical Technology Co., LTD., located in the beautiful ancient capital Xi 'an, is committed to the peptide industry, pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.
  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.