Glucagon 16941-32-5
4 Inquiries
16941-32-5
Reagent Grade
98%
shanghai
cellmano
1g/vial
2029-12-31
Cagrilintide,SS-31, Elamipretide,Semaglutide,Tirzepatide,Retatrutide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceWhite or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hyperglyBasic Info
-
Product Name:
Glucagon
Other Name:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS No.:16941-32-5
Molecular Formula:C153H225N43O49S
InChIKeys:MASNOZXLGMXCHN-ZLPAWPGGSA-N
Molecular Weight:3482.75
Exact Mass:3480.615723
EC Number:232-708-2
HScode:2937190000
Categories:
Characteristics-
PSA:
1564.04000
XLogP3:-6.01
Appearance:powder
Density:1.53±0.1 g/cm3(Predicted)
Refractive Index:1.682
Water Solubility:Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
Storage Conditions:−20°C
Hazard IdentificationClassification of the substance or mixture
Skin sensitization, Category 1
Acute toxicity - Category 4, Inhalation
Respiratory sensitization, Category 1
GHS label elements, including precautionary statements
Pictogram(s)
Signal word Danger
Hazard statement(s) H317 May cause an allergic skin reaction
H332 Harmful if inhaled
H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled
Precautionary statement(s) Prevention P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P272 Contaminated work clothing should not be allowed out of the workplace.
P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
P271 Use only outdoors or in a well-ventilated area.
P284 [In case of inadequate ventilation] wear respiratory protection.
Response P302+P352 IF ON SKIN: Wash with plenty of water/...
P333+P317 If skin irritation or rash occurs: Get medical help.
P321 Specific treatment (see ... on this label).
P362+P364 Take off contaminated clothing and wash it before reuse.
P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.
P317 Get medical help.
P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.
Storage none
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
Cagrilintide,SS-31, Elamipretide,Semaglutide,Tirzepatide,Retatrutide
-
Location:
Room C608, Chiyuan venture park
-
Payment Terms:
TT against copy of documents,100% TT in advance
-
Average lead Time:
10
-
Total Annual Revenue:
$5 million-$10 million
-
Total Employees:
11-50
Cellmano Biotech Limited focus on researching and developing solid phase peptide synthesis methodology since 2011. Cellmano has 10 years experience in researching, developing and manufacturing peptides by solid peptide phase synthesis.
Cellmano not only provides cosmeceuticals peptide & generic peptides to the customers, but also offer peptide CMO service and custom peptides synthesis service depend on the requirement from the customers over the world. Cellmano has state-of-the-art labs armed with excellent instrument for synthesis, purify and analysis .Cellmao control the quality by checking the materials, supervising produce process and finally QC. Cellmano keep all the synthesis records , purify methods and analysis result for every batch peptide product with staff and time invovled in the archives. Synthesizing by classical solid phase mothed invented by Prof.Bruce Merrified and purifying by HPLC instrument, Cellmano supply the customers excellent peptide products with reasonable price ,while maintain high quality, to help the customers to cut down their cost and shorten the time . Cellmano is trying her best to complement the inventory for more than 2000 popular peptide products, to make sure the customers can get what they need in one week from Cellmano’s inventory. Also to saitisfy diverse request from different customers for different projects, Cellmano provide custom synthesis for peptides from mgs to kgs with the purity from crude to 98% .
-
-
Inquiry History4 Inquiries
Country Product Purchase Quantity Date Posted
Belgium
Glucagon 16941-32-5 Pharmaceutical grade
10 PCS Jan 8, 2026
Belgium
Glucagon (1-29)
5 MG Jan 9, 2026
Netherlands
glucagon
1000 KG Feb 15, 2024
Bulgaria
Glucagon, not retatrutide, just glucagon
1 G May 10, 2026 Post an enquiry for this product
- Hot Searches
- retatrutide wholesale
- oxymetholone for sale
- tirzepatide peptide where to buy
- sodium lignosulfonate price
- boric acide
- menadione sodium bisulfite
- buy amino acid derivatives online
- natural flavouring agents
- buy adrenochrome
- azithromycin dihydrate api market price 2026
- aluminum chloride
- raw cosmetic materials
