Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Inhibitors > FOXO4-DRI for Sale > Longevity Peptide High Purity Foxo4-Dri with Best Price in USA Warehouse CAS 2460055-10-9
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - large image1
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image1
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image2
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image3
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image4
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image5
Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9 buy - image6

Longevity Peptide High Purity Foxo4-Dri with Best Price in USA Warehouse CAS 2460055-10-9

28 Inquiries

Unit Price: Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pesticide Grade

Content:

99%

Port:

QINGDAO

Brand:

QSC=Qingdao Baishiwei Chemical

Packaging:

25kg drum

Price valid (until):

2025-01-24

Company Type:
Trader
Location:
China
Qualification:
Main Products:

ghk cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9-Detailed Image 1

    Items Specifications
    Product Name Foxo4-Dri
    Purity 99%
    Trademark Osiris New Material Technology
    Appearance
    White Powder
    Payment Method Btc, Usdt, Wu, Bank Transfer, Paypal
    Origin China


    • FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of  FOXO4 and  p53. FOXO4-DRI is a senolytic peptide that induces  apoptosis of senescent cells

      Molecular Weight

      5358.06

      Appearance

      Solid

      Formula

      C228H388N86O64

      CAS No.
      Sequence

      D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)

      Sequence Shortening

      D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)

      Shipping

      Room temperature in continental US; may vary elsewhere.

      Storage

      Sealed storage, away from moisture

      Powder -80°C 2 years

      -20°C 1 year

      *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

      Shop Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9-Detailed Image 1 Shop Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9-Detailed Image 2

    • Senescent Cell Clearance: Research suggests that senescent cells accumulate in the body with age and contribute to age-related decline and diseases. FOXO4-DRI is designed to selectively target and induce the death of these senescent cells while sparing healthy cells. By promoting the clearance of senescent cells, it aims to potentially mitigate age-related conditions.

      Preclinical Studies: Studies conducted in animal models have shown promising results regarding the clearance of senescent cells and potential health benefits associated with reduced senescent cell burden. These studies have indicated improvements in various age-related conditions and tissue function.

      Experimental Nature: Despite its potential benefits in preclinical studies, the use of FOXO4-DRI remains largely experimental. Comprehensive human studies regarding its safety, efficacy, and long-term effects are limited.

      Safety and Efficacy in Humans: As of now, the safety profile and potential side effects of FOXO4-DRI in humans are not well-established due to the lack of comprehensive human trials. There's a need for further research to evaluate its safety, optimal dosage, and potential applications in human health.


    • Q: What's your MOQ ?

      A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.


      Q: Is there a discount ?
      A: Yes, for larger quantity, we always support with better price.

      Q: How to confirm the Product Quality before placing orders ?
      A: You can get free samples for some proucts, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests.

      Q: How to start orders or make payments ?
      A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.

      Q: How do you treat quality complaint ?
      A: First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
    • Shop Longevity Peptide High Purity Foxo4-Dri  with Best Price in USA Warehouse CAS 2460055-10-9-Detailed Image 3
      Shop Epitalon Epithalon peptide Epithalone Powder  CAS 307297-39-8-Detailed Image 3
    ECHEMI Editorial Reference
    FOXO4-DRI (Retro-Inverso) is a synthetic, slightly modified version of the standard FOXO4 protein. The modification prolongs half-life of the protein and allows it to interfere with normal FOXO4 function. FOXO4-DRI has been shown in research to prevent normal FOXO4 binding to p53, thereby allowing for elimination of senescent cells, improved organ function, and younger tissue “biological age.” FOXO4-DRI impacts insulin signaling, cell cycle regulation, and oxidative stress signaling pathways. FOXO4-DRI is a cell penetrating peptide shown to selectively induce apoptosis of senescent cells thereby reversing effects of aging in animal studies.
    Research & Reference Note

    Longevity Peptide High Purity Foxo4-Dri with Best Price in USA Warehouse CAS 2460055-10-9 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Categories:

    Inhibitors

  • Seller Information
    Business Type:

    Trader

    Main Products:

    ghk cu

    Location:

    No. 33688 Jingshi East Road, High-tech Zone, Jinan City, Shandong Province, Jinan Comprehensive Bonded Zone Customs supervision warehouse supporting office area 101-B3

    Payment Terms:

    100% TT in advance

    Average lead Time:

    120

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2021

  • Inquiry History
    28 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    Germany

    foxo4-dri

    1 G Aug 23, 2026
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    Norway

    FOXO4-DRI

    200 MG Sep 3, 2026
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.