Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - large image1
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image1
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image2
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image3
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image4
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image5
LL37  purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image6

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

XKY

Packaging:

5mg 10mg 15mg/vial 10vials/box

Price valid (until):

2025-03-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    • LL-37: functions as an antiviral and antibacterial peptide by inhibiting early steps in the viral replication cycle and perforating cytoplasmic bacterial membranes (25–27). In addition to penetrating bacterial membranes, LL-37 prevents biofilm formation and enhances bacterial phagocytosis
    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   

    Shop High Quality Peptides Calcifediol Teriparatide CAS 12583-68-5 Treat osteoporosis-Detailed Image 1

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 2

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 3


      our conpany


    Our company is mainly engaged in the export of fine chemicals, cosmetics raw materials, food additives, pharmaceutical intermediates and other products. Our products have been exported to more than 30 countries and regions such as the United States, Japan, the United Kingdom, etc. Our products have passed ISO-9001, CE, SGS and other international certifications.

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 4

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 5


      our advantage 


    1. High quality standards: All ingredients are tested for purity and performance.

    2. Competitive prices: We offer exceptional value without compromising quality.

    3. Customization: Solutions tailored to your specific needs and formulations.

    4. Reliable delivery: Timely and efficient transportation to ensure that your production schedule is met.

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 6


      Packing and shipping


    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 7

    Shop Semaglutide Powder For Lower Blood Sugar Weight Loss CAS 910463-68-2-Detailed Image 8


    Service:
    1. Any inquiries will be replied within 5 hours.
    2. Dedication to quality, supply & service.
    3. Strictly on selecting raw materials.
    4. OEM/ODM Available.
    5. Reasonable & competitive price, fast lead time.
    6. Sample is available for your evaluation & formulation development.


      RFQ 


    1. How to make an order?
    Send me inquiry here(or contact me and let me know how much quantity you need)

    2. What's the lead time and shipping ways?

    We will delivery to the package by FEDEX, DHL paket ,EMS , UPS and by air,by sea to you after receive your payment, it would take around 7-10days to your address.

    3. How do I keep the peptides when I receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods ?
    We could accept the payment through Paypal, T/T, Bank transfer and MoneyGram.


    Shipping information  


    Shop Super Quality Tirzepatide CAS 2023788-19-2 pharmaceutical raw materials Best Price Factory Supply-Detailed Image 9

    Shop Super Quality Tirzepatide CAS 2023788-19-2 pharmaceutical raw materials Best Price Factory Supply-Detailed Image 10

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Peptides

    Location:

    Shop No. 47, Jixin Plaza, No. 26 Renmin Avenue, Renmin Street, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2019

    Haikou Mingheng Technology Co., Ltd. is a modern and advanced enterprise specializing in the production and export of pharmaceutical intermediates, plant extracts, and other products. Products are widely used in health products, peptides and other fields. Our plant covers an area of 1000 m². The proposed workshop will be built according to GMP standards. We provide our customers with quality products and first-class service. Now, we can provide G-KG service to our customers.

    • High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.

    • Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.

    • Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.

    • Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.

    • Comprehensive Product Range: Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

      Company Profile

     




  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.