Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - large image1
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image1
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image2
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image3
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image4
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image5
High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide buy - image6

High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide

TDS 11 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

XINKAIYUE

Packaging:

10mg 20mg/vial,10 vials/box

Price valid (until):

2025-01-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Product Details

    Shop High Quality Peptides Calcifediol Teriparatide CAS 52232-67-4 Treat osteoporosis-Detailed Image 1 Shop High Quality Peptides Calcifediol Teriparatide CAS 52232-67-4 Treat osteoporosis-Detailed Image 2 Shop High Quality Peptides Calcifediol Teriparatide CAS 52232-67-4 Treat osteoporosis-Detailed Image 3 Shop High Quality Peptides Calcifediol Teriparatide CAS 52232-67-4 Treat osteoporosis-Detailed Image 4 Shop High Quality Peptides Calcifediol Teriparatide CAS 52232-67-4 Treat osteoporosis-Detailed Image 5

    Product name Teriparatide acetate
    color White
    Product synonyms FRAGMENT1-34;
    PARATHYROIDHORMONE(HUMAN,1-34);
    Teriparatideacetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;

    Paypment ways Paypal;
    BankTransfer;
    MoneyGram;T/T
    CAS number 52232-67-4
    Shipping ways UPS;FedEx;DHL;EMS;by air;by sea
    Molecular formula C172H278N52O47S2
    Specification 5mg 10mg 15mg/vial
    Molecular weight 3890.49792
    Origin China
    EINECS number 640-978-1
    Production Capacity 500000vials/week
    Storage conditions ‘-20°C
    Customized Acceptable
    Solubility Soluble to 0.40 mg/ml in water
    MOQ 1 box

    Teriparatide acetate

    Teriparatide mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.

    Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 7 Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 8

    Company Introduction

    XINKAIYUE is mainly engaged in the export of fine chemicals, cosmetic raw materials, food additives, pharmaceutical intermediates and other products,  which are widely used in medicine, health products, cosmetics, nutritional supplements, food additives and other fields.
    Our company has its own research and development team and production plant. Our company is dedicated to the development of  international markets. Our products are mainly exported to many countries and regions,
    such as Europe, America, South-east Asia, the Middle East and Africa etc. 
    In addition,we have professional and experienced engineers and scientists, providing new polypeptide drug biosynthesis solutions, which help partners stay  ahead of the polypeptide drug discovery, clinical development and market production.

    Company photos

    Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 9

    Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 10

    Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 11

    Our advantage

    rich experience
    1. Our company is a professional and leading factory with many years of experience in the pharmaceutical field in China.
    2. We have good feedback from customers all over the world.
    OEM service
    1.Add customer logo
    2. Redesign labels and packaging boxes according to customer requirements
    3. Bottle cap color can be customized
    Shipping service
    1. Shipped within 48 hours after payment is received.
    2. Small orders are shipped via express door-to-door.
    3. The goods arrive in 7-10 days
    24 hours service
    1.Reply your inquiry within 10 hours
    2. Continuously track goods and update information to customers
    3. After-sales service at any time

    Packaging and shipping

    Shop Semaglutide CAS 910463-68-2 for weight loss 5mg 10mg 15mg vial-Detailed Image 12

    FAQ:

    Q: How to order this product?
    A: You can click "chat now" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

    Q: How long can I receive my ordered goods?
    A: We ship by express door to door; you can receive it in 7-10 workdays.

    Q: What liquid should I add into the vial? And how much liquid needed?
    A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.(Depends on the specific product situation)

    Q: Will I have any side effects after using peptide?
    A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

    Q: How to store it?
    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.


    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • High Quality Customs Made Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Peptides

    Location:

    Shop No. 47, Jixin Plaza, No. 26 Renmin Avenue, Renmin Street, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2019

    Haikou Mingheng Technology Co., Ltd. is a modern and advanced enterprise specializing in the production and export of pharmaceutical intermediates, plant extracts, and other products. Products are widely used in health products, peptides and other fields. Our plant covers an area of 1000 m². The proposed workshop will be built according to GMP standards. We provide our customers with quality products and first-class service. Now, we can provide G-KG service to our customers.

    • High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.

    • Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.

    • Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.

    • Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.

    • Comprehensive Product Range: Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

      Company Profile

     




  • Inquiry History
    11 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.