Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > FOXO4-DRI for Sale > High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - large image1
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image1
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image2
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image3
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image4
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image5
High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping buy - image6

High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping

26 Inquiries

Unit Price:

$25/UNIT FOB

Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Tianjin

Brand:

tengchu

Packaging:

10mg*10vials

Price valid (until):

2026-10-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

ghk-cu,Semaglutide,tirzepatide,Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Linkman: Yara
    WhatsApp: +852 6011 9564
    Email : tengchu02@zhuanjinbio.com


      Product Detail  


    Product Description

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    Function & Application

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.


    MOQ 100, 10 days



      Company profile


    Hubei Tengchu Trading Co., Ltd. is a reliable Chinese supplier of health care materials,offer preferential price and high quality products.We invest large fund and brains into R&D, developing new products and pioneering new technics, to meet the demand of the market. All the products from our plants are the fruit of out R&D department, reaching the advanced standard of domestic market, many of which reach the international standard.Welcome the friends from all over the world and promote pleasant cooperation,we sincerely offer you the best quality products and services.

    Shop Cosmetic grade Anti-Aging Snap-8 Motsc Lose Weight Peptides-Detailed Image 1


      Packing & Delivery  


    Shop Best Price Relieve Stress Lyophilized Powder Semax CAS 80714-61-0 for Anxiety Memory Improvement-Detailed Image 3 Shop Best Price Relieve Stress Lyophilized Powder Semax CAS 80714-61-0 for Anxiety Memory Improvement-Detailed Image 4
    Remarks
    1. For packages weighing less than 10kg, they will be packed in aluminum foil bags with two PE
    bags inside, and then placed in cartons.
    2. For packages weighing more than 25kg, they will be packed in two PE bags inside, and then placed in a fiber drum.
    3. We will select the appropriate packaging and the quickest and most cost-effective method for delivering the goods to our customers. We will also track the parcel until it safely reaches the customer.
    4. We will make every effort to assist customers with customs clearance.


      FAQ


    Q:Can we print our logo on the product?

    A:Of course, we can do it. Just send us your logo design.


    Q:How about the price?  Can you make it cheaper?

    A:We always take the customer's benefit as the top priority.  Price is negotiable under different conditions, we are assuring you to get the most competitive price.


    Q:How Can I place an order?

    A:You could directly place an order via Alibaba, and sure you could just send us inquiry to any of our sales representatives to get detailed order information, and we will explain' the detail process.

    ECHEMI Editorial Reference
    FOXO4-DRI (Retro-Inverso) is a synthetic, slightly modified version of the standard FOXO4 protein. The modification prolongs half-life of the protein and allows it to interfere with normal FOXO4 function. FOXO4-DRI has been shown in research to prevent normal FOXO4 binding to p53, thereby allowing for elimination of senescent cells, improved organ function, and younger tissue “biological age.” FOXO4-DRI impacts insulin signaling, cell cycle regulation, and oxidative stress signaling pathways. FOXO4-DRI is a cell penetrating peptide shown to selectively induce apoptosis of senescent cells thereby reversing effects of aging in animal studies.
    Research & Reference Note

    High Purity 99% Peptides Fox04-Dri FOXO4-Dri for Anti-Aging Fast Shipping is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

  • Seller Information
    Business Type:

    Trader

    Main Products:

    ghk-cu,Semaglutide,tirzepatide,Retatrutide

    Location:

    Room 68-5-501, Lianqiang Residential Area, No. 371 Union Road, Union Street, Xinhua District, Shijiazhuang City, Hebei Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2022

  • Inquiry History
    26 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    United States

    FOXO4

    10 PCS Nov 15, 2025
    United States

    Fox04

    1 G Nov 10, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.