Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - large image1
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image1
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image2
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image3
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image4
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image5
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7 buy - image6

China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Reagent Grade

Content:

98%

Port:

Shanghai, Shenzhen or Beijing

Brand:

HANDOM CHEM

Packaging:

1g/Bottle, 2g/Bottle, 3g/Bottle or 5g/Bottle

Price valid (until):

2025-09-30

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,HCG,Retatrutide,Cagrilintide,Medetomidine

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Details 


    Product Name: LL-37

    Synonyms: LL37; LL37,human; LL-37, human; Antimicrobial Peptide LL-37 human; antimicrobial peptides; LL-37, LL37, CAMP; LL-37 human acetate; Cathelicidin LL 37 (human); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Cathelicidin LL-37

    CAS No.: 154947-66-7

    EINECS No.: 211-519-9

    Molecular Formula: C205H340N60O53

    Molecular Weight: 4493.74


    Brief Introduction:

    LL-37 is the only cathelicidin antimicrobial peptide found in the human body. It is composed of 37 amino acids at the N-terminus of the cathelicidin protein, and the starting amino acids are L-L, hence the name LL-37. LL-37 is the main protein in neutrophils and is widely present in neutrophils, bone marrow, cervical and vaginal squamous epithelial cells. The LL-37 precursor consists of a signal peptide, a cathelin conserved region and 37 amino acid residues, when the cell is activated, it is cleaved by serine protease 3 and other proteolytic enzymes to produce biologically active LL-37, which has antibacterial, antifungal and antiviral functions, as well as chemotaxis and immune stimulation/regulation.


    Shop China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7-Detailed Image 1



    Sequence:

    Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser



    Mechanism of Action:

    LL-37 may interact with the phospholipid bilayer through the N-terminus of the polymer, disrupt the arrangement of phospholipid molecules in the cell membrane, change the membrane permeability, affect the structure and function of the cell membrane, cause a large amount of intracellular substances to extravasate, and cause cell death; it may also cause cell death by inhibiting the synthesis of intracellular nucleic acids and proteins, enzyme activity and cell wall synthesis.

    Shop China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7-Detailed Image 2



    Functions of Antimicrobial Peptide LL-37 (human):

    ✹ Antimicrobial:
    As an important member of the natural immune system, LL-37 has strong antimicrobial activity both in vivo and in vitro, including Gram-positive bacteria (such as Staphylococcus aureus, Streptococcus, etc.), Gram-negative bacteria (such as Salmonella, Escherichia coli, etc.), fungi and viruses. Moreover, LL-37 also has a certain selective killing effect on some fungi, viruses, tumor cells and protozoa.

    ✹ Regulate the Release of Immune and Inflammatory Mediators:
    LL-37 can cause immune cell differentiation and chemotaxis, induce cell differentiation, cytokine release, neutralize endotoxins and anti-tumor, etc., and enhance the body's ability to resist harmful microorganisms.


    Advantages:

    Compared with traditional antibiotics, Antimicrobial Peptide LL-37 human can kill pathogens, is not easy to produce drug resistance, and is not easy to produce immune rejection reactions. It is an important effector molecule of the natural immune system.


    Application Prospects of LL-37:

    ✹ New Drugs:
    Low expression of TLR2 and LL-37 and low level of serum LL-37 in children with atopic dermatitis (AD) suggest that AD has problems such as innate immunity and skin barrier function defects. Vitamin D may activate vitamin D receptors and promote LL-37 expression through the TLR2 pathway, thereby protecting AD. Perhaps in the future, LL-37-related drugs can be designed to assist vitamin D in combating atopic dermatitis.
    Neonatal sepsis is mainly caused by infection. With the emergence of drug-resistant bacteria, antibiotic selection has become increasingly difficult, so it is particularly important to improve one's own resistance. Studies have shown that vitamin D can increase the expression of the body's antimicrobial peptide LL-37, thereby improving the body's ability to defend against infection and providing strong protection for antibiotic treatment. This will provide ideas for designing drugs that replace antibiotics.

    ✹ Animal Feed Additives:
    LL-37 has a broad antibacterial spectrum and high antibacterial activity, bacteria are not easy to develop drug resistance, it can also neutralize endotoxins and can be regarded as a new alternative to antibiotics. Therefore, choosing a suitable expression template to express LL-37 analogs will promote the production of animal feed additives with high antibacterial efficiency and high nutrition, making it have certain economic benefits.

    ✹ Preservatives:
    LL-37 and CP1 are produced on a large scale through genetic engineering, they have strong antibacterial activity, small relative molecular mass, high antibacterial activity when heated at 121℃ for 30 minutes, good water solubility, safe and non-toxic, and not easy to develop drug resistance. Adding an appropriate amount of antimicrobial peptides to milk has a certain preservation effect on storage.


    Laboratory & Equipment Display:


    Shop China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7-Detailed Image 3

    Test Items Specifications
    Appearance White powder
    Purity (HPLC) Not less than 98.0%
    Acetate Content (HPLC) Less than 15.0%
    Peptide Content (N%) Not less than 75.0%
    Water Content (Karl Fischer) Not more than 10.0%
    MS (ESI) Conforms
    Mass Balance 95.0% ~ 105.0%


    Packaging:

    1g/Bottle, 2g/Bottle, 3g/Bottle, 5g/Bottle or according to the specific requirements from customers.

    Shop China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7-Detailed Image 4


    Payment Methods:


    Shop China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7-Detailed Image 5


    Storage Conditions:

    Stored in a cool dry place away from sunlight and moisture.


    Shelf Life:

    24 months from the date of manufacturing when stored under the above mentioned conditions.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,HCG,Retatrutide,Cagrilintide,Medetomidine

    Location:

    RM702, Building 21, Liuhe Road, Ganjingzi Dist, Dalian, Liaoning, China

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2020

    Dalian Handom Chemicals Co., Ltd.(HDC CHEM) is a professional 15-Year-Experienced Supplier of APIs & Intermediates, Pharmaceutical Excipients, Food & Nutraceutical Ingredients, Personal Care Chemicals and Specialty Chemicals from northeast of China, which strives to provide customers with high-quality products and comprehensive service across all over the world, our main products cover Retatrutide Lyophilized Powder, Retatrutide, Tirzepatide, Tirzepatide Lyophilized Powder, Semaglutide, Mazdutide, Cagrilintide, LL-37, Thymosin Alpha 1(Thymosin α1), MT-2, MOTS-c, HEP-1, TB-500, NAD+, GHK-Cu, Glow, Klow, Selank, Semax, Glutathione, 5-Amino-1MQ, ARA-290, SS-31, DSIP, SNAP-8, Medetomidine, Medetomidine Hydrochloride, Salcaprozate Sodium, Sodium 8-(2-hydroxybenzamido)octanoate, 2,6-Dimethyl Beta Cyclodextrin, mPEG-DMG-2K, mPEG-DSPE-2K, 1,2-Distearoyl-sn-3-phosphacholine(DSPC), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine(DOPE), Pharmaceutical Grade Fructose, Lactose Anhydrous, Lactose Monohydrate, Orotic acid anhydrous, Orotic acid monohydrate, 6-Methyluracil, Chitosan, Mushroom Chitosan, Chitosan Hydrochloride, Chitosan Oligosaccharide, Alginate Oligosaccharide, Inulin, L-Serine, Mung Bean Peptide, Walnut Peptide, Rice Peptide, Oyster Peptide, Sea Cucumber Peptide, Hydrolyzed Keratin, Folic Acid, Vitamin E Acetate, Vitamin B2, Riboflavin Sodium Phosphate, Pyridoxal 5'-phosphate Monohydrate, Vegan Vitamin D3, Vitamin A Palmitate, Vitamin A Acetate, Apple Pectin, Citrus Pectin, Sunflower Pectin, Salidroside, Urolithin A, Milk Thistle Extract, Saffron Extract, Red Clover Extract, Sulforaphane, Glucoraphanin, Soy Isoflavones, Soy Lecithin, Soya Lecithin, Egg Yolk Lecithin, Phosphatidylserine, Cooling Agent WS-3, Cooling Agent WS-5, Cooling Agent WS-10, Cooling Agent WS-12, Cooling Agent WS-23, Cooling Agent WS-27, Menthyl Lactate, Menthyl PCA, Avobenzone, Benzophenone-3 (UV-9), Benzophenone-4 (UV-284), Bis-ethylhexyloxyphenol Methoxyphenyl Triazine (Bemotrizinol), Diethylaminohydroxybenzoyl Hexyl Benzoate (UVA Plus), Diethylhexyl Butamido Triazone (Iscotrizinol), Disodium Phenyl Dibenzimidazole Tetrasulfonate (DPDT), Ethylhexyl Triazone (UVT-150), Homosalate, Octocrylene, 2-Ethylhexyl Salicylate (Octyl Salicylate), 2-Ethylhexyl Trans-4-Methoxycinnamate (OMC), 2-Phenylbenzimidazole-5-Sulfonic Acid (UV-T), Lanolin Anhydrous, Palmitoyl Tripeptide-5, Dipeptide Diaminobutyroyl Benzylamide Diacetate, Biotinoyl Tripeptide-1, etc.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.