 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory direct sales high Purity peptide LL37 5mg white powder

Factory direct sales high Purity peptide LL37 5mg white powder buy - large image1

Factory direct sales high Purity peptide LL37 5mg white powder buy - image1

Factory direct sales high Purity peptide LL37 5mg white powder buy - image2

Factory direct sales high Purity peptide LL37 5mg white powder buy - image3

Factory direct sales high Purity peptide LL37 5mg white powder buy - image4

Factory direct sales high Purity peptide LL37 5mg white powder

Name: Factory direct sales high Purity peptide LL37 5mg white powder
Brand: Xi Wu
SKU: pr2608051563
Price: 30 USD
Availability: InStock

TDS 2 Inquiries

Unit Price:

$30-35/UNIT EXW

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

Xi Wu

Packaging:

10vials/box

Price valid (until):

2026-09-05

Contact Supplier

 Chat Now

Yiwu Xiwu Technology Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

 Visit Store

Product Description
Seller Information
Inquiry History

Description
  Product Detail

Composition:
LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.

Mechanism of Action:
It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.

Research Advantages:
Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.

Intended Research Population:
This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.

Items Specifications

Product Peptides

Apperance White Fine Powder

Purity >99%

Company Introduction

Our company is an R&D-oriented sales company. With its excellent quality and highly competitive prices, enjoy a very high reputation in China's sales industry. The company adheres to international standards such as ISO and provides customized services. Based on mass production, high-volume wholesale prices third-party testing, and certificate reports, our products provide high-quality products to numerous domestic and foreign enterprises. Our values are "integrity, pragmatism, innovation, and development We hope to cooperate with you with high-quality products and competitive prices. All products undergo strict quality inspection before leaving the factory, and ODM/OEM can be according to the needs of different customers. We are committed to providing you with the most competitive prices to ensure you stand out in the market, and we accept various payment methods. Our has a complete return and exchange policy. Special designs, special transportation channels, and free home delivery. Our products are exported to the United States, Australia, Canada, etc.

Our company is committed to the business philosophy of"bringing great health to the world and letting the world experience Chinese style services". Good quality of goods is the foundation of service and business.
The company has a professional product testing laboratory, and all saleable goods comply with the report testing. Excellent good cooperative manufacturers,in line with ISO and other qualification requirements standards, in order to ensure that the quality of the goods meet the buyer's choice.In 2026, we will set off again and meet again on the road ahead!

Why Choose US



Package & Shipping Method

Our Advantages

We always adhere to the market demand oriented, and constantly develop more effective high-tech products, our product market has been all over the world, mainly exported to the United States, Europe, South Africa, Asia Pacific and other countries and regions, has rich market experience, but also will provide you with the perfect price service.
We also have a perfect logistics mechanism, as long as you are in a certain corner of the earth, we will do our best to deliver products to your home.
We also provide samples as a trial order for you to test, because of the good quality of the products, so highly valued by foreign customers.

Certificate



FAQ

Q1: What's your MOQ?

A:For the regular produced products, our MOQ is 1box, for other customized products, our MOQ starts from 50boxes.

Q2: How to confirm the product quality before placing the order?

A:Sample could be provided, and we have inspection report.

Q3: Which kind of payment terms do you accept??

A: Paypal,T/T ,BTC,USDT, Bank Transfer etc.

Q4. Are there opportunities for partnerships or collaborations with your company?

We are open to exploring partnerships and collaborations with you. Please contact our business development team to discuss potential opportunities.

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Research & Reference Note

Factory direct sales high Purity peptide LL37 5mg white powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sources

PubChem

ClinicalTrials.gov

FDA Drugs@FDA

NIH
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Bulk Drug Intermediates

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water
Seller Information

Business Type:
Trader

Main Products:
GLP-1,Retatrutide,Selank,Tirzepatide

Location:
Room 307, No. 3, Building 7, Area 4, Pingchou, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province

Payment Terms:
TT against copy of documents,100% TT in advance

Average lead Time:
1

Total Annual Revenue:
Less than $1 million

Total Employees:
11-50

Year of Establishment:
2026

Inquiry History

2 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg	Pharmaceutical Grade/99	$50/MT FOB	Changsha Caoquan	Inquiry
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity Pharmaceutical Grade	Pharmaceutical Grade/99		Sanli Biotechnology Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry

Items	Specifications
Product	Peptides
Apperance	White Fine Powder
Purity	>99%

Factory direct sales high Purity peptide LL37 5mg white powder

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches