Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 high purity LL37 CAS 154947-66-7 with factory price
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - large image1
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image1
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image2
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image3
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image4
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image5
LL37  high purity LL37 CAS 154947-66-7 with factory price buy - image6

LL37 high purity LL37 CAS 154947-66-7 with factory price

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

tianjin

Brand:

JNSL

Packaging:

5mg 10mg 15mg per vial; 10vials/box

Price valid (until):

2025-05-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide,Weight loss peptide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    name peptide
    color White
    specification 2mg 5mg 10mg
    Purity ≥99%

    Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 1 Shop high quality Tirzepatide tirz 2023788-19-2 with factory price-Detailed Image 2

    Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 3 Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 4

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Weight Loss

    we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

    This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!


      Company Profile  


    Jinan Silk Road Trading Co., Ltd.  We are engaged in the development, marketing and sales of intermediates, Peptides, Ste roids, Sterol, chemicals and other products.
    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.
    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.
    Sincerely welcome domestic and external customers to negotiate and trade.

    Shop Tirz 2023788-19-2 with high quality-Detailed Image 3 Shop Tirz 2023788-19-2 with high quality-Detailed Image 4

    Shop high quality Tirzepatide tirz 2023788-19-2 with factory price-Detailed Image 7



    • The importance of peptides



    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.
    • Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 8



    Certifications

    Shop Tirz 2023788-19-2 with high quality-Detailed Image 5  



    Product Packaging  and transportation

    Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 9 Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 10 Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 11

    Shop Tirz 2023788-19-2 with high quality-Detailed Image 6 Shop Tirz 2023788-19-2 with high quality-Detailed Image 7

    Our Advantages

    1)All purity>99%.

    2)High quality with competitive price.

    3)We are manufacturer and can provide high quality products with factory price.

    Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 15 Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 16

    Fast and safe delivery.

    1)Parcel can be sent out in 24 hours after payment tracking number available.

    2)Secure and discreet shipment verious transportation methods for your choice.

    3)Customs pass rate >99%.

    We have clients throughout the world.

    1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the custome


    Why choose us?

    Professional, Rich Experience.

    1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

    2)Full experience of large numbers containers loading in Chinese sea port.

    How to proceed your order:

    Step 1:Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel.



      Payment Method


    Shop Tirzepatide CAS 2023788-19-2 with best price and good quality-Detailed Image 14

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide,Weight loss peptide

    Location:

    jinan fenghuang guojiguangchang

    Year of Establishment:

    2024

    Company Profile
    10 Years' Manufacturer and Exporter of Chemicals
    we have more than 10 years of experience in manufacturing intermediates, Peptides, Sterol, chemicals and other products.
    Products Exported to Over 30 Countries
    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America, Europe, Australia, Southeast Asia, the Middle East and South Africa.
    Call Us to Get More Details
    In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question. We look forward to cooperating with you soon.
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.