Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - large image1
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image1
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image2
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image3
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image4
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image5
Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image6

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid

TDS 1 Inquiries

Unit Price:

$80-90/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

LM

Packaging:

5mg/vials,10vials/box

Price valid (until):

2026-07-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Description: 

      LL37, also known as antimicrobial peptide LL-37, is a 37-amino acid at the N-terminal of Cathelicidin protein, named for its original amino acid L-L, and is the only antimicrobial peptide found in humans derived from Cathelicidin.

      LL37 is the main protein in the special granules of neutrophils. It is synthesized and stored in neutrophils in the form of inactivated precursor protein. Ll37 is widely present in bone marrow, testis, neutrophils, monocytes, tongue, esophagus, cervix, vaginal squamous epithelial cells, and epithelial cells of skin, gastrointestinal tract and respiratory tract.

    Product Benefits

    Alternative to Antibiotics
    Reduces Antifungal Effects
    Reduces Antiviral Effects
    Treats Issues with Stomach/Gut
    Faster Recovery from Wounds/Injuries

      The importance of peptides
        Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Product name LL-37
    CAS no. 597562-32-8
    Molecular Formula C205H341N61O52
    Molecular Weight 4492.27854


    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 3 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 4

    Shop Factory supply  Hot best price Delta sleep-inducing Stress regulatory Peptide DSIP-Detailed Image 4

    Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
     Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world.Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 6 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 7 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 8 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 9 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 10 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 11

    

    We supply large quantities of peptides.In addition to regular specifications, we can also customize according to customer requirements.
     The minimum order quantity is 1 box(10vials), we welcome customers to order samples for testing.Please contact us for COA or HPLC.
     We believe that as long as the quality is good enough will lead to long-term cooperation.Looking forward to your inquiry.

    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 12 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 13


    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 14


    packaging and shipping

    Suitable packaging:
    The packing suits you best would be choosen to cross customs safely. Or if you have your own ideal way, it could be also taken in consideration

    Secure shipping:
    Shipping by professional forwarder Security EMS/DHL/TNT /FedEx/UPS, Aus Post, Royal Mail express,etc. Door to door service.

    Competitive prices:
    A discount would be given when you make a large order. VIP price for next orders.

    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 15

    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 16

    FAQ

      Q1:How to send order?
      A:Send order list to us,we quote best price for you,then ship package out and offer tracking nubmer to you after payment send.

      Q2:Do you have samples for our reference?
    A:Sure,we can offer smaples,the customers will pay the freight.

      Q3:Any discount if order more?
    A:Sure,the price is negotiable,you can get much better price if order big quantity.

     Q4:What about the delivery time?
    A:Ship within 1-2 days after confirming payment (excluding Chinese holidays).5-10 working days to arrive your address.

     Q5:What kind of payment terms do you accept?
    A:Payment can be made by Bank transfer, BTC,Credite Card,TT,Paypal,Alipay,Wechat,Visa,Mastercard,Appple Pay,Goolge Pay.


                                                                                                             Our   Advantage

    1.GMP factory guarantee good quality.

    2.Offer factory competitive prices.

    3.Rich experience for safe and fast shipping.

    4.Twenty-four hours on-time service.


    Certificates
    • Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    COA

    Company Profile
       Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.