Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

SYS

Packaging:

Vial/Bottle/Bag/Carton

Price valid (until):

2025-08-29

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

GLP/GIP/GCG Cosmetic Peptides GH/GHRH/GHRP

  • Product Description

  • Seller Information

  • Description


      Detail  


    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 1


    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.


      Advantage 


    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 2
    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 3

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


      Manufacturing  


    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 4
    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 5 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 6 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 7 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 8 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 9 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 10

    1. Expertise in Peptide Synthesis

    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.


    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


      Global Service  


    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 11

     Who We Serve

    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners


      Product Delivery  


    Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 12 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 13 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 14 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 15 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 16


     About Us 


    SYS specialize in the development and global distribution of high-quality research-use-only (RUO) raw materials, including peptides, small molecules, and biochemical reagents.

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.


    1. Superior Product Quality

    Product quality is the foundation of our business.  Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.


    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.


    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

    Items Specifications
    vial

    mg

    tude g
    bag kg

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    GLP/GIP/GCG Cosmetic Peptides GH/GHRH/GHRP

    Location:

    Room 118, Building No. 20, No. 1-42, Lane 83, Hongxiang North Road, Lingang Area, Shanghai Free Trade Zone, China.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    SYS™ is a global provider of GMP-stander, high-purity peptide APIs and custom peptide solutions, serving clients in the research, pharmaceutical, and industrial sectors.

    With 7+ years of experience in synthetic peptide development, we empower R&D teams, CDMOs, and pharma companies with reliable, scalable, and precise manufacturing capabilities — from milligram-scale to multi-kilogram production.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.