Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - large image1
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image1
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image2
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image3
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image4
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image5
LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties buy - image6

LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties

TDS 3 Inquiries

Unit Price:

$90-100/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

LM

Packaging:

5mg/vial 10vials/box

Price valid (until):

2027-02-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Pls input...

    Name :Julia

    Whatsapp/wechat:+86 17532387010

    Email:954261192@qq.com

    LL 37 peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes

    Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.


    The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.



    Sequence : [LL-37, 37 aa]

    MW : 4 493.4 Da (C205H340N60O53)

    Purity : > 99%

    Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, 

    Peptide Solubility Guideline

    Bulk peptide quantities available


    What is the Benefit of LI 37 Peptide?

    1. Immune Support
    2. Antimicrobial Properties
    3. Wound Healing
    4. Anti-inflammatory Effects
    5. Angiogenesis Promotion 
    6. Anti-tumor Potential
    7. Skin Health
    8. Neuroprotective Effects

    Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 1 Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 2

    Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 3


     

       Our Conpany

     


    LingMi BioTechnology Co., Ltd, The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!

    Shop MOTS-C CAS 1627580-64-6 High Purity Mots-C Peptide Lyophilized Mots-C for Lose Weight Anti-Aging-Detailed Image 3 Shop MOTS-C CAS 1627580-64-6 High Purity Mots-C Peptide Lyophilized Mots-C for Lose Weight Anti-Aging-Detailed Image 4


     

      Why choose us? 

     


    1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available .

    2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Double-clearance express, safer and more efficient

    Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 5 Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 6


     

    Packaging

     


    Shop MOTS-C CAS 1627580-64-6 High Purity Mots-C Peptide Lyophilized Mots-C for Lose Weight Anti-Aging-Detailed Image 8


     

      Advantage&shipping   

     


    Shop MOTS-C CAS 1627580-64-6 High Purity Mots-C Peptide Lyophilized Mots-C for Lose Weight Anti-Aging-Detailed Image 9 Shop MOTS-C CAS 1627580-64-6 High Purity Mots-C Peptide Lyophilized Mots-C for Lose Weight Anti-Aging-Detailed Image 10


     

       RAQ  

     


    Q1: How to confirm the Product Quality before placing orders?
    A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.
    Q2: Can you supply free samples?
    A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.
    Q3: How do you treat quality complaints?
    A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
    Q4: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.
    Q5: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


    Shop LL-37 CAS 154947-66-7       Factory stock, with immune support and antibacterial properties-Detailed Image 1 


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • LL-37 CAS 154947-66-7 Factory stock, with immune support and antibacterial properties Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    COA

    Company Profile
       Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.