Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > CAS 307297-39-8 LL37 10mg Vials Epitalon Peptides Supply Ghk-Cu Retatrutide
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - large image1
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image1
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image2
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image3
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image4
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image5
CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide buy - image6

CAS 307297-39-8 LL37 10mg Vials Epitalon Peptides Supply Ghk-Cu Retatrutide

TDS

Unit Price:

$110/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

MingHeng

Packaging:

5mg/vial,10 vials/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Agrochemicals,Chemical Pesticides,Peptides

  • Product Description

  • Seller Information

  • Description


     Purity 99% LL37 


    Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 1


    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   

    L L-37

    Bioactive 
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 2 Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 3



      • Company Profile


          Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 6

        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 7

        Why choose us? 

        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 8


        Packing and shipping 

         

        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 9

        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 10


           Tracking number 


        Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 11

    Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 12




     Exibition   


    Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 14 Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 15 Shop Medicine Grade Injectable Peptide Oxytocin Acetate Muscle Building Stimulant-Detailed Image 16

    Certificates
    • CAS 307297-39-8 LL37 10mg Vials Epitalon  Peptides Supply Ghk-Cu Retatrutide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Agrochemicals,Chemical Pesticides,Peptides

    Location:

    haikou

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2024

    Certifications:

    coa

    Company Profile


    High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.
    Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.
    Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.
    Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.
    Comprehensive Product Range : Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.