Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > RT SM TR Peptide Raw Material | Factory Supply with 99% Purity
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - large image1
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image1
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image2
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image3
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image4
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image5
RT SM TR Peptide Raw Material | Factory Supply with 99% Purity buy - image6

RT SM TR Peptide Raw Material | Factory Supply with 99% Purity

TDS 9 Inquiries

Unit Price:

$1.8-2/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

Customization Available

Packaging:

5mg*10vials,10vials/box

Price valid (until):

2026-06-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

      Product

    contact information:

    Name: Kimi

    Email address : haitai19870620@outlook.com

    Whatsapp : +85244681823


    Product Name : Tirzepatide
    CAS NO : 2381089-83-2
    Appearance : white powder
    Content : 99%

    Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 1 Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 2 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 3 Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 4 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 5 Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 6 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 7 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 8


     

      Why choose us  

    1.  Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.
    2.  Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.

    3.  Excellent sales team can provide customers with integrated and professional services.

    4.  Accept various OEM & ODM services to meet the different needs of different customers,low MOQ.

    5.  Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.

    FAQ 

    1.  Do you accept customization?

    RE: We can provide corresponding customized solutions according to the specific needs of customers.

    2.   Can you provide samples?

    RE: We can provide samples to customers and send them to consumers in time by express.

    3.  How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.

    4.  How long is your lead time?

    RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.

    5.  What is your terms of payment ?

    RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.

    6.  Do you have OEM or ODM service of product?

    Re: Sure. If needed, we can customize products for you.

    7.  How can you guarantee the goods you offer is qualified ?

    Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.

    8.How will you deliver the goods?
    RE:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

    Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 9 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 10 Shop Customizable Retatrutide Semaglutide Tirzepatide 10mg 30mg Lyophilized Powder for Weight Loss-Detailed Image 11


    Shipping & Delivery Shop Customizable Retatrutide Semaglutide Tirzepatide 10mg 30mg Lyophilized Powder for Weight Loss-Detailed Image 12


    Effect drawing displayShop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 13 Shop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 14 Shop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 15

    Certificates
    • RT SM TR Peptide Raw Material | Factory Supply with 99% Purity Certificates 1

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    9 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.