 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity buy - large image1

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity buy - image1

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity buy - image2

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity buy - image3

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity buy - image4

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity

Name: TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity
Brand: Customization Available
SKU: pr2605292253
Price: 2.3 USD
Availability: InStock

TDS 18 Inquiries

Unit Price: Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Brand:

Customization Available

Packaging:

5mg*10vials,10vials/box

Sample Available:

Yes

Price valid (until):

2026-09-15

Contact Supplier

 Chat Now

Guangzhou Duo Run Trading

Company Type:

Trader

Location:

China

Payment Terms:

100% TT in advance

Average Lead Time:

7 days

Qualification:

Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

 Visit Store

Product Details
Seller Information
Inquiry History

Description

Product contact information

Name: Kimi

Email address : xiaoyucheng106@gmail.com

Whatsapp : +85244681823

Product Name :
CAS NO :	2381089-83-2
Appearance :	white powder
Content :	99%

Why choose us

1. Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.

2. Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.

3. Excellent sales team can provide customers with integrated and professional services.

4. Accept various OEM & ODM services to meet the different needs of different customers，low MOQ.

5. Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.

FAQ

1. Do you accept customization?

RE: We can provide corresponding customized solutions according to the specific needs of customers.

2. Can you provide samples?

RE: We can provide samples to customers and send them to consumers in time by express.

3. How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.

4. How long is your lead time?

RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.

5. What is your terms of payment ?

RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.

6. Do you have OEM or ODM service of product?

Re: Sure. If needed, we can customize products for you.

7. How can you guarantee the goods you offer is qualified ?

Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.

8.How will you deliver the goods?
RE:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

Company Profile

Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

Shipping & Delivery

Effect drawing display

ECHEMI Editorial Reference

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

Research

Class:

Actin-sequestering protein / 43-amino-acid peptide

Status:

Research compound — Not FDA approved (investigational: RGN-259 for dry eye / neurotrophic keratitis)

Mechanism:

A naturally occurring 43-amino-acid peptide (Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH) that binds G-actin (sequesters monomeric actin), preventing F-actin polymerization. Promotes cell migration, angiogenesis, wound healing, and anti-inflammatory responses via integrin-linked kinase (ILK) and HIF-1α/VEGF pathways. TB-500 is the synthetic fragment Ac-LKKTETQ (MW ~895) often sold under this CAS.

Activity note:

Thymosin Beta-4 is an actin-binding protein, not a receptor agonist. Functional activity is measured by actin sequestration (Kd ~0.7–1 μM) and cell migration assays, not EC₅₀.

Source:

Goldstein AL, et al. Vitam Horm. 2003;66:257–296. RegeneRx RGN-259 clinical program.DOI

Clinical Development:

NCT02974907; NCT02600429; NCT00376974

References

DrugBank:

DB04951

PubChem:

PubChem

UNII:

549LM7U24W

Literature:

PubMed: Goldstein AL et al. (2003) — Review; ClinicalTrials.gov: ARISE-1 (NCT02974907)

Disclaimer:

Thymosin Beta-4 (TB-500) is NOT FDA-approved for human therapeutic use. RGN-259 (Tβ4 ophthalmic solution) is an investigational drug not yet approved. TB-500 sold on research-chemical marketplaces is a synthetic fragment and is not an approved medicine. This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

Location:
Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

Payment Terms:
100% TT in advance

Average lead Time:
7 days

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
5-10

Year of Establishment:
2026

Company Profile

Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

Inquiry History

18 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide acetate	1 G	Oct 23, 2026
Peru	Teriparatide acetate	2 MT	Oct 20, 2026
United States	Teriparatide acetate	3 MT	Oct 16, 2026
Belgium	Erdafitinib	10 G	Sep 20, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
United States	Teriparatide kit of 10 2mg vials	1 MT	Sep 7, 2026
United States	teriparatide	1 G	Sep 6, 2026
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
United States	Teriparatide	1 KG	May 28, 2026
Bulgaria	teripatatide	1	May 17, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
TER10 Teriparatide \|TER10\|Hot Selling \|High >99% Quality\|Factory DirectSupply\|Fast Shipping99% purity + perfect after-sales service	Research Grade/99	$30-35/UNIT FOB	Yiwu Nianwu	Inquiry
SNAP-8 Cosmetic Peptide, Highly recognized as a safe anti-aging	Pharmaceutical Grade/99	$35-40/UNIT FOB	Anhui Ruibang Trading Co., Ltd	Inquiry
Splenopentin	Industrial Grade/99	$10-13/G FOB	Hantong Kuntai Biological Technology Co., LTD	Inquiry
teriparatide acetate	Tech Grade/99	$16/KG EXW	DAHAI BIOCHEM LTD	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry

TR RT SM TB500 Peptide Raw Material | Factory Supply with 99% Purity

Product Details

Seller Information