Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - large image1
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image1
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image2
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image3
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image4
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image5
TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service buy - image6

TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service

15 Inquiries

Unit Price:

$30-35/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

Henan Kunyao

Packaging:

10mg*10vials

Sample Available:

Yes

Price valid (until):

2026-12-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

PEPTIDES

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact information  


    Whatsapp:+86 199 399 68217 

    Mailbox: kyemi01che@163.com


      Our service 


    1. We supply peptides, APIs and intermediates to meet your needs;
    2. We will reply to your inquiry within 24 hours;
    3. Strictly select raw materials. Our Q&A team will strictly check the quality of each product before delivery;
    4. Reasonable and competitive price and fast delivery time;
    After delivery, we will help you track it every two days until you receive the product. When you receive the goods, if you have any questions, please contact us and we will provide you with a solution;
    6. 100% safe delivery and guaranteed delivery.


    Company profile  


    Focus on the research and development, production and customized services of high-quality peptides. With excellent technical strength and strict quality control system, the company provides reliable peptide products and solutions for scientific research institutions, pharmaceutical enterprises and biotechnology enterprises around the world.
    Strong ability to lay the foundation of quality.
    Advanced technology platform: equipped with internationally advanced peptide synthesis equipment and purification system, adopting cutting-edge technologies such as solid-phase synthesis (SPPS) and liquid-phase synthesis, it can support research and development from mg to kg, and ensure high purity and activity of products.
    Strict quality control: following the ISO 9001 quality management system, each batch of products has undergone multidimensional tests, including high performance liquid chromatography (HPLC) and mass spectrometry (MS), and complete quality inspection reports are provided to ensure the quality traceability of the whole production process.
    Efficient customized service: It has a professional R&D team, which can quickly respond to customers' needs, support complex sequence synthesis, customize modified peptide segments (such as ation, fluorescence labeling, polyethylene glycol modification, etc.), and provide one-stop service from solution design to delivery.


    Payment  


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 1 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 2 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 3 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 4 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 5


      FQA    


    Q: How to store it?
    Answer: If it has not been opened, put it in a cool and dry place; If opened, it can be refrigerated to 2-5 degrees.
    Q: How do I order this product?
    A: You can click "Contact Supplier", or send an email to my inbox, send a consultation, leave a message if possible, and we will contact you as soon as possible, and then discuss the details of the order.
    Q: What is the delivery time?
    A: Delivery will be made within 48 hours after receipt of payment. Small orders are delivered by express delivery. The goods will arrive in about 7 to 10 days.
    Q: Is it cash on delivery?
    A: In most cases, we don't support cash on delivery.
    Q: What is the price of the goods?
    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.
    You need to contact me to get the latest product price, and we guarantee to provide you with the most favorable price.
    Q: About after-sales service?
    A: After purchasing our products, we have a professional technical team and after-sales team to serve you and solve all your future problems.


    Product Detail 


    Items Specifications
    CAS NO 12020-86-9
    Storage Dry powder: Store at -20℃;After reconstitution store at 2°C‑8°C
    Purity ≥99%


       Transportation and packaging


    Parameter Details
    CAS No. No public CAS number
    Alias TER10, Elastic Repair Peptide, Elastic Support Peptide
    Molecular Formula C₅₉H₈₇N₁₅O₁₆
    Structural Features Synthetic linear active peptide with a specific targeted amino acid sequence. It has a stable molecular structure, enzymatic hydrolysis resistance and good biocompatibility. It can specifically bind to skin elastic fiber-related targets, regulate elastin and microfibril protein metabolism, help maintain the integrity of the dermal elastic fiber network, and possess multiple biological activities including elastic support, firming repair and anti-sagging.
    Appearance White to off-white loose lyophilized powder with high purity and low impurities. Easily soluble in sterile pure water and conventional buffer solutions. After reconstitution, it is a colorless, clear and transparent liquid without precipitation or turbidity.
    Storage Condition Store frozen at -20℃, sealed and protected from light. Avoid repeated freezing and thawing. After opening and reconstitution, it is recommended to store at 2–8℃ for short-term use and apply as soon as possible to maintain stable peptide activity.
    Research Direction 1. Research on skin elastic fiber structure and function

    2. Research on dermal elastic network remodeling mechanism

    3. Research on skin sagging and elasticity decline

    4. Research on anti-sagging, firming and supporting skincare peptides
    Core Efficacy 1. Regulate the expression of elastic fiber-related proteins and help maintain the structural integrity of the dermal elastic fiber network

    2. Improve reduced skin elasticity, sagging, weakness and poor resilience, and enhance skin support and firmness

    3. Relieve skin laxity, fine lines and blurred contour caused by aging, environmental stress and matrix degeneration

    4. Cooperate in maintaining dermal matrix homeostasis and help improve skin elasticity, firmness and contour definition


    Shop TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service-Detailed Image 6 Shop TER10 Teriparatide |TER10|Hot Selling |High >99% Quality|Factory DirectSupply|Fast Shipping99% purity + perfect after-sales service-Detailed Image 7


      Factory photos



    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 10 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 11

    Shop G210 High-Quality Pharmacy Grade G210 High-Purity Peptide Fast Deliveryperfect after-sales service-Detailed Image 10 Shop G210 High-Quality Pharmacy Grade G210 High-Purity Peptide Fast Deliveryperfect after-sales service-Detailed Image 11

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    PEPTIDES

    Location:

    Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

    Year of Establishment:

    2026

  • Inquiry History
    15 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United Kingdom

    Supply

    Mar 5, 2024
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Belgium

    Erdafitinib

    10 G Sep 20, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.