Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder

LL-37

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

154947-66-7

C205H340N60O53

POIUWJQBRNEFGX-XAMSXPGMSA-N

0

211-519-9

White to off-white

Organic Reagents

Soluble to 1 mg/ml in water

GLP-1R agonist

FDA-approved (Ozempic / Wegovy / Rybelsus)

Long-acting, selective glucagon-like peptide-1 (GLP-1) receptor agonist with 94% sequence homology to human GLP-1. Engineered for extended half-life (~1 week) via albumin binding (fatty acid acylation at Lys26) and resistance to DPP-4 degradation (Aib substitution at position 8). Promotes insulin secretion, inhibits glucagon release, delays gastric emptying, and reduces appetite via central nervous system GLP-1R activation.

Potent, selective GLP-1R agonist. Reported binding affinity Ki = 0.38 ± 0.06 nM. Semaglutide is a human GLP-1 analog with structural modifications for albumin binding (C18 fatty diacid at Lys26) and enzymatic stability (Aib8 substitution).

Lau J, et al. J Med Chem. 2015;58(18):7370-7380. Wilding JPH, et al. N Engl J Med. 2021;384(11):989-1002.DOI

NCT03548935; NCT03552757; NCT01720446; NCT02692716

Ozempic, Wegovy, Rybelsus (approved 2017-12-05)

CHEMBL2108724

DB13928

D10025

PubChem

NEJM: Wilding et al. (2021) — STEP-1; NEJM: Marso et al. (2016) — SUSTAIN-6; J Med Chem: Lau et al. (2015) — Discovery of Semaglutide; FDA: Ozempic (NDA 209637)

Semaglutide is approved as a prescription medicine (Ozempic, Wegovy, Rybelsus) in certain jurisdictions. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.